ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: AVARP13045_T100
Price: $0.00
SKU
AVARP13045_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-HTR2C (AVARP13045_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HTR2C
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceHorse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 85%
Peptide SequenceSynthetic peptide located within the following region: SPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMA
Concentration1.0 mg/ml
Blocking PeptideFor anti-HTR2C (AVARP13045_T100) antibody is Catalog # AAP30717 (Previous Catalog # AAPP01374)
Sample Type Confirmation

HTR2C is supported by BioGPS gene expression data to be expressed in Daudi

ReferenceSaltzman, A.G., et al., (1991) Biochem. Biophys. Res. Commun. 181:1469-1478.
Gene SymbolHTR2C
Gene Full Name5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled
Alias SymbolsHTR1C, 5-HT1C, 5-HT2C, 5HTR2C, 5-HTR2C
NCBI Gene Id3358
Protein Name5-hydroxytryptamine receptor 2C
Description of TargetThis is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with g proteins that activate a phosphatidylinositol . calcium second messenger system.
Uniprot IDP28335
Protein Accession #NP_000859
Nucleotide Accession #NM_000868
Protein Size (# AA)458
Molecular Weight52kDa
Protein InteractionsSNTA1; CALM1; LIN7C; MPDZ; DLG4; APBA1; GNAQ; HTR2C; ARRB2;
  1. What is the species homology for "HTR2C Antibody - N-terminal region (AVARP13045_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Horse, Pig, Rabbit".

  2. How long will it take to receive "HTR2C Antibody - N-terminal region (AVARP13045_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HTR2C Antibody - N-terminal region (AVARP13045_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HTR2C Antibody - N-terminal region (AVARP13045_T100)"?

    This target may also be called "HTR1C, 5-HT1C, 5-HT2C, 5HTR2C, 5-HTR2C" in publications.

  5. What is the shipping cost for "HTR2C Antibody - N-terminal region (AVARP13045_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HTR2C Antibody - N-terminal region (AVARP13045_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HTR2C Antibody - N-terminal region (AVARP13045_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HTR2C Antibody - N-terminal region (AVARP13045_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HTR2C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HTR2C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HTR2C"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HTR2C"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HTR2C"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HTR2C"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HTR2C Antibody - N-terminal region (AVARP13045_T100)
Your Rating
We found other products you might like!