HTR2B Antibody - C-terminal region (ARP90815_P050)

Catalog No: ARP90815_P050

Host: Rabbit
Target Name: HTR2B
Sample Tissue: Mouse Lung lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse HTR2B
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: KHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLTENDGDKAEEQVSY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HTR2B (ARP90815_P050) antibody is Catalog # AAP90815

Target Info

• Gene Symbol: HTR2B
• Gene Full Name: 5-hydroxytryptamine (serotonin) receptor 2B
• Alias Symbols: 5-HT2B, 5-HT-2B, 5-HT-2F, AJ012488, AV377389
• NCBI Gene Id: 15559
• Protein Name: 5-hydroxytryptamine receptor 2B
• Description of Target: G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various ergot alkaloid derivatives and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of downstream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and downstream signaling cascades and promotes the release of Ca2+ ions from intracellular stores (By similarity). Plays a role in the regulation of dopamine and 5-hydroxytryptamine release, 5-hydroxytryptamine uptake and in the regulation of extracellular dopamine and 5-hydroxytryptamine levels, and thereby affects neural activity. May play a role in the perception of pain. Plays a role in the regulation of behavior, including impulsive behavior. Required for normal proliferation of embryonic cardiac myocytes and normal heart development. Protects cardiomyocytes against apoptosis. Plays a role in the adaptation of pulmonary arteries to chronic hypoxia. Plays a role in vasoconstriction. Required for normal osteoblast function and proliferation, and for maintaining normal bone density. Required for normal proliferation of the interstitial cells of Cajal in the intestine.
• Uniprot ID: Q02152
• Protein Accession #: NP_032337.2
• Nucleotide Accession #: NM_008311.2
• Protein Size (# AA): 479
• Molecular Weight: 52 kDa