Search Antibody, Protein, and ELISA Kit Solutions

HTR2B Antibody - C-terminal region (ARP90815_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Predicted Species Reactivity:
Mouse
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
HTR2B
Official Gene Full Name:
5-hydroxytryptamine (serotonin) receptor 2B
NCBI Gene Id:
15559
Protein Name:
5-hydroxytryptamine receptor 2B
Swissprot Id:
Q02152
Protein Accession #:
NP_032337.2
Nucleotide Accession #:
NM_008311.2
Alias Symbols:
5-HT2B, AJ012488, AV377389
Description of Target:
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various ergot alkaloid derivatives and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of downstream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and downstream signaling cascades and promotes the release of Ca2+ ions from intracellular stores (By similarity). Plays a role in the regulation of dopamine and 5-hydroxytryptamine release, 5-hydroxytryptamine uptake and in the regulation of extracellular dopamine and 5-hydroxytryptamine levels, and thereby affects neural activity. May play a role in the perception of pain. Plays a role in the regulation of behavior, including impulsive behavior. Required for normal proliferation of embryonic cardiac myocytes and normal heart development. Protects cardiomyocytes against apoptosis. Plays a role in the adaptation of pulmonary arteries to chronic hypoxia. Plays a role in vasoconstriction. Required for normal osteoblast function and proliferation, and for maintaining normal bone density. Required for normal proliferation of the interstitial cells of Cajal in the intestine.
Protein Size (# AA):
479
Molecular Weight:
52 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HTR2B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HTR2B.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of mouse HTR2B
Peptide Sequence:
Synthetic peptide located within the following region: KHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLTENDGDKAEEQVSY
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-HTR2B (ARP90815_P050) antibody is Catalog # AAP90815
Datasheets/Manuals:
Printable datasheet for anti-HTR2B (ARP90815_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...