Catalog No: AVARP13073_T100
Price: $0.00
SKU
AVARP13073_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

HTR1F Antibody - N-terminal region (AVARP13073_T100)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-HTR1F (AVARP13073_T100) antibody
Product Info
ReferenceLovenberg,T.W., et al., (1993) Proc. Natl. Acad. Sci. U.S.A. 90 (6), 2184-2188
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HTR1F
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIV
Concentration1.0 mg/ml
Blocking PeptideFor anti-HTR1F (AVARP13073_T100) antibody is Catalog # AAP30714 (Previous Catalog # AAPP01371)
Gene SymbolHTR1F
Gene Full Name5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled
Alias Symbols5HT6, MR77, 5-HT1F, HTR1EL, 5-HT-1F
NCBI Gene Id3355
Protein Name5-hydroxytryptamine receptor 1F
Description of TargetThe 5-HT1F receptor is present in both human vascular and neuronal tissue. This gene is localized at 3p12.
Uniprot IDP30939
Protein Accession #NP_000857
Nucleotide Accession #NM_000866
Protein Size (# AA)366
Molecular Weight42kDa
Protein InteractionsCAV1;
  1. What is the species homology for "HTR1F Antibody - N-terminal region (AVARP13073_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Pig, Rabbit".

  2. How long will it take to receive "HTR1F Antibody - N-terminal region (AVARP13073_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HTR1F Antibody - N-terminal region (AVARP13073_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HTR1F Antibody - N-terminal region (AVARP13073_T100)"?

    This target may also be called "5HT6, MR77, 5-HT1F, HTR1EL, 5-HT-1F" in publications.

  5. What is the shipping cost for "HTR1F Antibody - N-terminal region (AVARP13073_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HTR1F Antibody - N-terminal region (AVARP13073_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HTR1F Antibody - N-terminal region (AVARP13073_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HTR1F Antibody - N-terminal region (AVARP13073_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HTR1F"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HTR1F"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HTR1F"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HTR1F"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HTR1F"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HTR1F"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HTR1F Antibody - N-terminal region (AVARP13073_T100)
Your Rating