Loading...
Catalog No: AVARP13042_T100
Price: $0.00
SKU
AVARP13042_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-HTR1B (AVARP13042_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HTR1B
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKV
Concentration1.0 mg/ml
Blocking PeptideFor anti-HTR1B (AVARP13042_T100) antibody is Catalog # AAP30711 (Previous Catalog # AAPP01368)
ReferenceL, et al., (2004) Biol. Psychiatry 55 (3), 225-233
Gene SymbolHTR1B
Gene Full Name5-hydroxytryptamine (serotonin) receptor 1B, G protein-coupled
Alias SymbolsS12, 5-HT1B, HTR1D2, HTR1DB, 5-HT-1B, 5-HT1DB, 5-HT-1D-beta
NCBI Gene Id3351
Protein Name5-hydroxytryptamine receptor 1B
Description of TargetThe pathophysiology of depression remains enigmatic, although abnormalities that involve serotonin signaling have been implicated. The serotonin 1B receptor [5-hydroxytryptamine (5-HT1B) receptor] interacts with p11. p11 increases localization of 5-HT1B receptors at the cell surface. p11 is increased in rodent brains by antidepressants or electroconvulsive therapy, but decreased in an animal model of depression and in brain tissue from depressed patients. Overexpression of p11 increases 5-HT1B receptor function in cells and recapitulates certain behaviors seen after antidepressant treatment in mice. p11 knockout mice exhibit a depression-like phenotype and have reduced responsiveness to 5-HT1B receptor agonists and reduced behavioral reactions to an antidepressant.
Uniprot IDP28222
Protein Accession #NP_000854
Nucleotide Accession #NM_000863
Protein Size (# AA)390
Molecular Weight44kDa
Protein InteractionsMDFI; HTR1D; HTR1B; HTR1A; GSTK1; NME2;
  1. What is the species homology for "HTR1B Antibody - N-terminal region (AVARP13042_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "HTR1B Antibody - N-terminal region (AVARP13042_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HTR1B Antibody - N-terminal region (AVARP13042_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HTR1B Antibody - N-terminal region (AVARP13042_T100)"?

    This target may also be called "S12, 5-HT1B, HTR1D2, HTR1DB, 5-HT-1B, 5-HT1DB, 5-HT-1D-beta" in publications.

  5. What is the shipping cost for "HTR1B Antibody - N-terminal region (AVARP13042_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HTR1B Antibody - N-terminal region (AVARP13042_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HTR1B Antibody - N-terminal region (AVARP13042_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HTR1B Antibody - N-terminal region (AVARP13042_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HTR1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HTR1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HTR1B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HTR1B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HTR1B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HTR1B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HTR1B Antibody - N-terminal region (AVARP13042_T100)
Your Rating
We found other products you might like!