Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP52217_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP52217_P050-FITC Conjugated

ARP52217_P050-HRP Conjugated

ARP52217_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-135942 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HSPH1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-HSPH1 (ARP52217_P050)
Peptide Sequence Synthetic peptide located within the following region: EENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HSPH1 (ARP52217_P050) antibody is Catalog # AAP52217 (Previous Catalog # AAPY03639)
Datasheets/Manuals Printable datasheet for anti-HSPH1 (ARP52217_P050) antibody
Sample Type Confirmation

HSPH1 is strongly supported by BioGPS gene expression data to be expressed in 721_B, MCF7

Target Reference Meares,G.P., (2008) Cell. Signal. 20 (2), 347-358
Publications

Du, ZN; Rong, CT; Hui, S; Peng, Z; Jin, SH; Li, SJ; Wang, HY; Li, JY; Expression and function of HSP110 family in mouse testis after vasectomy. , (2016). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26952955

Gene Symbol HSPH1
Official Gene Full Name Heat shock 105kDa/110kDa protein 1
Alias Symbols DKFZp686M05240, HSP105, HSP105A, HSP105B, KIAA0201, NY-CO-25
NCBI Gene Id 10808
Protein Name Heat shock protein 105 kDa
Description of Target HSPH1 prevents the aggregation of denatured proteins in cells under severe stress, on which the ATP levels decrease markedly. It inhibits HSPA8/HSC70 ATPase and chaperone activities.
Swissprot Id Q92598
Protein Accession # NP_006635
Nucleotide Accession # NM_006644
Protein Size (# AA) 858
Molecular Weight 97kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HSPH1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HSPH1.
Protein Interactions HUWE1; UBC; SUMO2; SUMO3; HSPA8; MDM2; ILK; SET; PPM1G; PLOD2; HSPA4; DPYSL2; CTNNA1; PARVA; PUS7; SAMHD1; XPO7; FAF1; CARM1; SEC23A; PRMT3; FARSB; RANBP3; HIRIP3; HIST1H4A; USP11; SF1; UGP2; HECW2; FBXO6; TARDBP; CFTR; METTL21A; env; NOS2; HSP90AB1; HSP9
Write Your Own Review
You're reviewing:HSPH1 Antibody - middle region (ARP52217_P050)
Your Rating