Search Antibody, Protein, and ELISA Kit Solutions

HSPH1 antibody - middle region (ARP52217_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52217_P050-FITC Conjugated

ARP52217_P050-HRP Conjugated

ARP52217_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Heat shock 105kDa/110kDa protein 1
Protein Name:
Heat shock protein 105 kDa
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DKFZp686M05240, HSP105, HSP105A, HSP105B, KIAA0201, NY-CO-25
Replacement Item:
This antibody may replace item sc-135942 from Santa Cruz Biotechnology.
Description of Target:
HSPH1 prevents the aggregation of denatured proteins in cells under severe stress, on which the ATP levels decrease markedly. It inhibits HSPA8/HSC70 ATPase and chaperone activities.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HSPH1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HSPH1.
The immunogen is a synthetic peptide directed towards the middle region of human HSPH1
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-HSPH1 (ARP52217_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HSPH1 (ARP52217_P050) antibody is Catalog # AAP52217 (Previous Catalog # AAPY03639)
Printable datasheet for anti-HSPH1 (ARP52217_P050) antibody
Sample Type Confirmation:

HSPH1 is strongly supported by BioGPS gene expression data to be expressed in 721_B, MCF7

Target Reference:
Meares,G.P., (2008) Cell. Signal. 20 (2), 347-358

Du, ZN; Rong, CT; Hui, S; Peng, Z; Jin, SH; Li, SJ; Wang, HY; Li, JY; Expression and function of HSP110 family in mouse testis after vasectomy. , (2016). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26952955

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...