HSPB2 Recombinant Protein (Human) (OPCA04785)

Catalog No: OPCA04785

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP
• Protein Sequence: MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-182 aa
• Tag: N-terminal GST-tagged
• Reference: Identification and characterization of the gene encoding a new member of the alpha-crystallin/small hsp family, closely linked to the alphaB-crystallin gene in a head-to-head manner. Iwaki A., Nagano T., Nakagawa M., Iwaki T., Fukumaki Y. Genomics 45:386-394(1997)

Target Info

• Gene Symbol: HSPB2
• Gene Full Name: heat shock protein family B (small) member 2
• Alias Symbols: DMPK-binding protein;heat shock 27kDa protein 2;heat shock protein beta-2;heat-shock protein beta-2;Hs.78846;HSP27;LOH11CR1K;MKBP.
• NCBI Gene Id: 3316
• Protein Name: Heat shock protein beta-2
• Description of Target: May regulate the kinase DMPK.
• Uniprot ID: Q16082
• Protein Accession #: NP_001532
• Nucleotide Accession #: NM_001541
• Protein Size (# AA): Recombinant
• Molecular Weight: 47.2 kDa