Search Antibody, Protein, and ELISA Kit Solutions

HSPB1 Antibody - C-terminal region (ARP30177_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP30177_T100-FITC Conjugated

ARP30177_T100-HRP Conjugated

ARP30177_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Heat shock 27kDa protein 1
NCBI Gene Id:
Protein Name:
Heat shock protein beta-1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CMT2F, DKFZp586P1322, HS.76067, HSP27, HSP28, Hsp25, HMN2B, SRP27
Replacement Item:
This antibody may replace item sc-1048 from Santa Cruz Biotechnology.
Description of Target:
HSPB1, like the other heat shock proteins, is part of a complex system of molecular chaperones in epidermal keratinocytes.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HSPB1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HSPB1.
The immunogen is a synthetic peptide directed towards the C terminal region of human HSPB1
Predicted Species Reactivity:
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-HSPB1 (ARP30177_T100)
Peptide Sequence:
Synthetic peptide located within the following region: SLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HSPB1 (ARP30177_T100) antibody is Catalog # AAP30177 (Previous Catalog # AAPS08907)
Printable datasheet for anti-HSPB1 (ARP30177_T100) antibody
Target Reference:
Boncinelli,E., (2006) J. Biol. Chem. 281 (12), 8169-8174

Narjoz, C. et al. Genomic consequences of cytochrome P450 2C9 overexpression in human hepatoma cells. Chem. Res. Toxicol. 22, 779-87 (2009). IHC, WB, Human 19445531

Sookoian, S; Castaño, GO; Scian, R; San Martino, J; Pirola, CJ; Heat Shock Protein 27 is down-regulated in Ballooned Hepatocytes of Patients with Nonalcoholic Steatohepatitis (NASH). 6, 22528 (2016). IHC, WB, Human 26935030

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...