Size:100 ul
$229.00
In stock
SKU
ARP30177_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30177_T100-FITC Conjugated

ARP30177_T100-HRP Conjugated

ARP30177_T100-Biotin Conjugated

HSPB1 Antibody - C-terminal region (ARP30177_T100)

Catalog#: ARP30177_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-1048 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human HSPB1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Complete computational species homology dataAnti-HSPB1 (ARP30177_T100)
Peptide SequenceSynthetic peptide located within the following region: SLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-HSPB1 (ARP30177_T100) antibody is Catalog # AAP30177 (Previous Catalog # AAPS08907)
Datasheets/ManualsPrintable datasheet for anti-HSPB1 (ARP30177_T100) antibody
Target ReferenceBoncinelli,E., (2006) J. Biol. Chem. 281 (12), 8169-8174
Publications

Narjoz, C. et al. Genomic consequences of cytochrome P450 2C9 overexpression in human hepatoma cells. Chem. Res. Toxicol. 22, 779-87 (2009). IHC, WB, Human 19445531

Sookoian, S; Castaño, GO; Scian, R; San Martino, J; Pirola, CJ; Heat Shock Protein 27 is down-regulated in Ballooned Hepatocytes of Patients with Nonalcoholic Steatohepatitis (NASH). 6, 22528 (2016). IHC, WB, Human 26935030

Gene SymbolHSPB1
Official Gene Full NameHeat shock 27kDa protein 1
Alias SymbolsCMT2F, DKFZp586P1322, HS.76067, HSP27, HSP28, Hsp25, HMN2B, SRP27
NCBI Gene Id3315
Protein NameHeat shock protein beta-1
Description of TargetHSPB1, like the other heat shock proteins, is part of a complex system of molecular chaperones in epidermal keratinocytes.
Swissprot IdP04792
Protein Accession #NP_001531
Nucleotide Accession #NM_001540
Protein Size (# AA)205
Molecular Weight23kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express HSPB1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express HSPB1.
Protein InteractionsPCSK9; HUWE1; UBC; GATA1; MAPKAPK2; AKT1; CRYAB; MAP3K7; SUMO2; HAUS1; CEP57; AARSD1; BAG3; IRS4; HSF1; LCE3A; TGFB1I1; SUMO1; NEDD8; MDM2; ASB6; ASB10; ASB17; WWOX; ASB4; ZBTB1; RPA3; RPA2; RPA1; EZH2; ESR1; SOX2; NPM1; PLG; CS; MAPKAPK3; INS; HSPB1; SGA
Write Your Own Review
You're reviewing:HSPB1 Antibody - C-terminal region (ARP30177_T100)
Your Rating
Aviva HIS tag Deal
Aviva Travel Grant
Aviva Live Chat
Aviva Pathways