SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP30175_P050
Price: $0.00
SKU
ARP30175_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-HSPA9 (ARP30175_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse, Rat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, IP, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human HSPA9
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Dog: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-HSPA9 (ARP30175_P050) antibody is Catalog # AAP30175 (Previous Catalog # AAPS08906)
Sample Type Confirmation

HSPA9 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Other Applications Image 1 DataIP Suggested Anti-HSPA9 Antibody
Positive Control: NT2 CELL/BRAIN TISSUE
ReferenceShi,M., (2008) J. Neuropathol. Exp. Neurol. 67 (2), 117-124
Other Applications Image 2 DataIP Suggested Anti-HSPA9 antibody
Titration: 2 ug/ml
Positive Control: Mouse brain homogenate
Other Applications Image 3 DataIHC Suggested Anti-HSPA9 antibody
Titration: 2 ug/ml
Positive Control: Human brain stem cells
Gene SymbolHSPA9
Gene Full NameHeat shock 70kDa protein 9 (mortalin)
Alias SymbolsCSA, MOT, MOT2, SAAN, CRP40, EVPLS, GRP75, PBP74, GRP-75, HSPA9B, SIDBA4, MTHSP75, HEL-S-124m
NCBI Gene Id3313
Protein NameStress-70 protein, mitochondrial
Description of TargetHSPA9 belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. HSPA9 is a heat-shock cognate protein. This protein plays a role in the control of cell proliferation. It may also act as a chaperone.CSHL1 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. This particular family member is expressed in placental villi, although it was originally thought to be a pseudogene. In fact, alternative splicing suggests that the majority of the transcripts would be unable to express a secreted protein.The product encoded by this gene belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. This gene encodes a heat-shock cognate protein. This protein plays a role in the control of cell proliferation. It may also act as a chaperone. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. The protein encoded by this gene is an inositol 1,4,5-trisphosphate (InsP3) 5-phosphatase and contains a Sac domain. The activity of this protein is specific for phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate. Alternatively spliced transcript variants have been observed, but most of them are not thought to be protein-coding.
Uniprot IDP38646
Protein Accession #NP_004125
Nucleotide Accession #NM_004134
Protein Size (# AA)679
Molecular Weight75kDa
Protein InteractionsGPX7; FUS; CDKN2A; UBC; TP53; YKT6; CDKN1A; CDC20; CEP250; TUBGCP2; CEP57; AURKB; TUBG1; AURKA; SUMO2; SUMO3; NEDD1; SPRTN; CEP76; HAUS2; TUBGCP4; STAU1; GRSF1; NEDD8; MDM2; EED; RAP1GDS1; PFAS; GINS3; ATG3; OSGEP; BZW2; ABHD14A; TNFAIP8; FERMT2; AIP; CNB
  1. What is the species homology for "HSPA9 Antibody - C-terminal region (ARP30175_P050)"?

    The tested species reactivity for this item is "Human, Mouse, Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "HSPA9 Antibody - C-terminal region (ARP30175_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HSPA9 Antibody - C-terminal region (ARP30175_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HSPA9 Antibody - C-terminal region (ARP30175_P050)"?

    This target may also be called "CSA, MOT, MOT2, SAAN, CRP40, EVPLS, GRP75, PBP74, GRP-75, HSPA9B, SIDBA4, MTHSP75, HEL-S-124m" in publications.

  5. What is the shipping cost for "HSPA9 Antibody - C-terminal region (ARP30175_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HSPA9 Antibody - C-terminal region (ARP30175_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HSPA9 Antibody - C-terminal region (ARP30175_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "75kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HSPA9 Antibody - C-terminal region (ARP30175_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HSPA9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HSPA9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HSPA9"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HSPA9"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HSPA9"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HSPA9"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HSPA9 Antibody - C-terminal region (ARP30175_P050)
Your Rating
We found other products you might like!