- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
HSPA8 Antibody - N-terminal region : Biotin (ARP48445_P050-Biotin)
Datasheets/Manuals | Printable datasheet for anti-HSPA8 (ARP48445_P050-Biotin) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Goat, Pig, Sheep, Zebrafish |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | Biotin |
Application | IHC, WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HSPA8 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100% |
Peptide Sequence | Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-HSPA8 (ARP48445_P050-Biotin) antibody is Catalog # AAP48445 (Previous Catalog # AAPY01867) |
Sample Type Confirmation | HSPA8 is strongly supported by BioGPS gene expression data to be expressed in Jurkat, MCF7 |
Reference | Luciano,M., (er) Eur. J. Hum. Genet. (2008) In press |
Gene Symbol | HSPA8 |
---|---|
Gene Full Name | Heat shock 70kDa protein 8 |
Alias Symbols | LAP1, HSC54, HSC70, HSC71, HSP71, HSP73, LAP-1, NIP71, HEL-33, HSPA10, HEL-S-72p |
NCBI Gene Id | 3312 |
Protein Name | Heat shock cognate 71 kDa protein |
Description of Target | HSPA8 belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. HSPA8 is a heat-shock cognate protein. The protein binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Two alternatively spliced variants have been characterized to date.The product encoded by this gene belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. This gene encodes a heat-shock cognate protein. This protein binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Two alternatively spliced variants have been characterized to date. |
Uniprot ID | P11142 |
Protein Accession # | NP_006588 |
Nucleotide Accession # | NM_006597 |
Protein Size (# AA) | 646 |
Molecular Weight | 71kDa |
Protein Interactions | FUS; HSPBP1; TRIM38; STUB1; ISG15; UBC; TP53; BAG1; BAG3; IL32; NMI; AIRE; HAUS2; TUBGCP4; CEP250; TUBGCP2; TUBGCP3; TUBG1; AURKA; SUMO2; SUMO3; MDM2; LGALS3BP; CDKN1A; CDC20; HAUS1; STAU1; ST13; HSPA4; HSPA2; DNAJA1; GABRB1; EDRF1; DNAJC9; HSPA4L; HSPH1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "HSPA8 Antibody - N-terminal region : Biotin (ARP48445_P050-Biotin)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Goat, Pig, Sheep, Zebrafish".
-
How long will it take to receive "HSPA8 Antibody - N-terminal region : Biotin (ARP48445_P050-Biotin)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "HSPA8 Antibody - N-terminal region : Biotin (ARP48445_P050-Biotin)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "HSPA8 Antibody - N-terminal region : Biotin (ARP48445_P050-Biotin)"?
This target may also be called "LAP1, HSC54, HSC70, HSC71, HSP71, HSP73, LAP-1, NIP71, HEL-33, HSPA10, HEL-S-72p" in publications.
-
What is the shipping cost for "HSPA8 Antibody - N-terminal region : Biotin (ARP48445_P050-Biotin)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "HSPA8 Antibody - N-terminal region : Biotin (ARP48445_P050-Biotin)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "HSPA8 Antibody - N-terminal region : Biotin (ARP48445_P050-Biotin)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "71kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "HSPA8 Antibody - N-terminal region : Biotin (ARP48445_P050-Biotin)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "HSPA8"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "HSPA8"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "HSPA8"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "HSPA8"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "HSPA8"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "HSPA8"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.