Search Antibody, Protein, and ELISA Kit Solutions

HSPA8 Antibody - N-terminal region (ARP48446_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48446_P050-FITC Conjugated

ARP48446_P050-HRP Conjugated

ARP48446_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Heat shock 70kDa protein 8
NCBI Gene Id:
Protein Name:
Heat shock cognate 71 kDa protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
HSC54, HSC70, HSC71, HSP71, HSP73, HSPA10, LAP1, MGC131511, MGC29929, NIP71
Replacement Item:
This antibody may replace item sc-137210 from Santa Cruz Biotechnology.
Description of Target:
HSPA8 belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. HSPA8 is a heat-shock cognate protein. The protein binds to nascent polypeptides
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HSPA8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HSPA8.
The immunogen is a synthetic peptide directed towards the N terminal region of human HSPA8
Predicted Species Reactivity:
Goat, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Tested Species Reactivity:
Human, Rat
Predicted Homology Based on Immunogen Sequence:
Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-HSPA8 (ARP48446_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HSPA8 (ARP48446_P050) antibody is Catalog # AAP48446 (Previous Catalog # AAPY01868)
Printable datasheet for anti-HSPA8 (ARP48446_P050) antibody
Additional Information:
IHC Information: Spleen
IHC Information: Tonsil
Target Reference:
Luciano,M., (er) Eur. J. Hum. Genet. (2008) In press

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...