Search Antibody, Protein, and ELISA Kit Solutions

HSPA8 Antibody - N-terminal region (ARP48445_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48445_P050-FITC Conjugated

ARP48445_P050-HRP Conjugated

ARP48445_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse, Rat
Predicted Species Reactivity:
Cow, Goat, Human, Mouse, Pig, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Heat shock 70kDa protein 8
NCBI Gene Id:
Protein Name:
Heat shock cognate 71 kDa protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
HSC54, HSC70, HSC71, HSP71, HSP73, HSPA10, LAP1, MGC131511, MGC29929, NIP71
Replacement Item:
This antibody may replace item sc-137210 from Santa Cruz Biotechnology.
Description of Target:
HSPA8 belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. HSPA8 is a heat-shock cognate protein. The protein binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Two alternatively spliced variants have been characterized to date.The product encoded by this gene belongs to the heat shock protein 70 family which contains both heat-inducible and constitutively expressed members. The latter are called heat-shock cognate proteins. This gene encodes a heat-shock cognate protein. This protein binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Two alternatively spliced variants have been characterized to date.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HSPA8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HSPA8.
The immunogen is a synthetic peptide directed towards the N terminal region of human HSPA8
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-HSPA8 (ARP48445_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HSPA8 (ARP48445_P050) antibody is Catalog # AAP48445 (Previous Catalog # AAPY01867)
Printable datasheet for anti-HSPA8 (ARP48445_P050) antibody
Sample Type Confirmation:

HSPA8 is strongly supported by BioGPS gene expression data to be expressed in Jurkat, MCF7

Target Reference:
Luciano,M., (er) Eur. J. Hum. Genet. (2008) In press

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...