Catalog No: ARP54649_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

HSPA6 Antibody - middle region (ARP54649_P050)

Datasheets/ManualsPrintable datasheet for anti-HSPA6 (ARP54649_P050) antibody
Product Info
ReferenceNoonan,E.J., (2007) Cell Stress Chaperones 12 (4), 393-402
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HSPA6
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Pig: 79%
Peptide SequenceSynthetic peptide located within the following region: EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV
Concentration0.5 mg/ml
Blocking PeptideFor anti-HSPA6 (ARP54649_P050) antibody is Catalog # AAP54649 (Previous Catalog # AAPP31440)
Gene SymbolHSPA6
Gene Full NameHeat shock 70kDa protein 6 (HSP70B')
Alias SymbolsHSP70B'
NCBI Gene Id3310
Protein NameHeat shock 70 kDa protein 6
Description of TargetIn cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.
Uniprot IDP17066
Protein Accession #NP_002146
Nucleotide Accession #NM_002155
Protein Size (# AA)643
Molecular Weight71kDa
  1. What is the species homology for "HSPA6 Antibody - middle region (ARP54649_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Pig".

  2. How long will it take to receive "HSPA6 Antibody - middle region (ARP54649_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HSPA6 Antibody - middle region (ARP54649_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "HSPA6 Antibody - middle region (ARP54649_P050)"?

    This target may also be called "HSP70B'" in publications.

  5. What is the shipping cost for "HSPA6 Antibody - middle region (ARP54649_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HSPA6 Antibody - middle region (ARP54649_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HSPA6 Antibody - middle region (ARP54649_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "71kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HSPA6 Antibody - middle region (ARP54649_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HSPA6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HSPA6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HSPA6"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HSPA6"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HSPA6"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HSPA6"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HSPA6 Antibody - middle region (ARP54649_P050)
Your Rating