Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP53693_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP53693_P050-FITC Conjugated

ARP53693_P050-HRP Conjugated

ARP53693_P050-Biotin Conjugated

HSPA4L Antibody - C-terminal region (ARP53693_P050)

Catalog#: ARP53693_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-118470 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human HSPA4L
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 80%
Complete computational species homology data Anti-HSPA4L (ARP53693_P050)
Peptide Sequence Synthetic peptide located within the following region: KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HSPA4L (ARP53693_P050) antibody is Catalog # AAP53693 (Previous Catalog # AAPP30535)
Datasheets/Manuals Printable datasheet for anti-HSPA4L (ARP53693_P050) antibody
Target Reference Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Publications

Du, ZN; Rong, CT; Hui, S; Peng, Z; Jin, SH; Li, SJ; Wang, HY; Li, JY; Expression and function of HSP110 family in mouse testis after vasectomy. , (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26952955

Gene Symbol HSPA4L
Official Gene Full Name Heat shock 70kDa protein 4-like
Alias Symbols APG-1, Osp94, HSPH3
NCBI Gene Id 22824
Protein Name Heat shock 70 kDa protein 4L
Description of Target HSPA4L belongs to the heat shock protein 70 family. HSPA4L possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.
Swissprot Id O95757
Protein Accession # NP_055093
Nucleotide Accession # NM_014278
Protein Size (# AA) 839
Molecular Weight 95kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HSPA4L.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HSPA4L.
Protein Interactions SUMO2; STUB1; TTC1; SGTA; HSPA8; HSF1; UBC; IPO7; SEC23A; RANBP3; STAT1; PPP2R2A; GARS; APEH; PUS7; LUC7L2; METTL21A; PAXIP1; DIAPH1; NUP188; NUBP2; VPS26A; TERF2; PHLDA1; TUSC2; TCEAL1; DOK2; USF2; KRT8;
Write Your Own Review
You're reviewing:HSPA4L Antibody - C-terminal region (ARP53693_P050)
Your Rating