Search Antibody, Protein, and ELISA Kit Solutions

HSPA4L Antibody - C-terminal region (ARP53693_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP53693_P050-FITC Conjugated

ARP53693_P050-HRP Conjugated

ARP53693_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Heat shock 70kDa protein 4-like
NCBI Gene Id:
Protein Name:
Heat shock 70 kDa protein 4L
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
APG-1, Osp94, HSPH3
Replacement Item:
This antibody may replace item sc-118470 from Santa Cruz Biotechnology.
Description of Target:
HSPA4L belongs to the heat shock protein 70 family. HSPA4L possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HSPA4L.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HSPA4L.
The immunogen is a synthetic peptide directed towards the C terminal region of human HSPA4L
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 80%
Complete computational species homology data:
Anti-HSPA4L (ARP53693_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HSPA4L (ARP53693_P050) antibody is Catalog # AAP53693 (Previous Catalog # AAPP30535)
Printable datasheet for anti-HSPA4L (ARP53693_P050) antibody
Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Du, ZN; Rong, CT; Hui, S; Peng, Z; Jin, SH; Li, SJ; Wang, HY; Li, JY; Expression and function of HSP110 family in mouse testis after vasectomy. , (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26952955

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...