Catalog No: ARP53636_P050
Price: $0.00
SKU
ARP53636_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

HSPA1L Antibody - C-terminal region (ARP53636_P050)

Datasheets/ManualsPrintable datasheet for anti-HSPA1L (ARP53636_P050) antibody
Product Info
ReferenceBuraczynska,M., (er) Clin. Sci. (2008) In press
Tested Species ReactivityHuman, Rat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IP
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human HSPA1L
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Goat: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
Concentration0.5 mg/ml
Blocking PeptideFor anti-HSPA1L (ARP53636_P050) antibody is Catalog # AAP53636 (Previous Catalog # AAPP30476)
Gene SymbolHSPA1L
Gene Full NameHeat shock 70kDa protein 1-like
Alias SymbolsHSP70T, hum70t, HSP70-1L, HSP70-HOM
NCBI Gene Id3305
Protein NameHeat shock 70 kDa protein 1-like
Description of TargetHSPA1L is a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. This gene encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which also encode isoforms of the 70kDa heat shock protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP34931
Protein Accession #NP_005518
Nucleotide Accession #NM_005527
Protein Size (# AA)641
Molecular Weight70kDa
Protein InteractionsTUBG1; TP53; CDC20; AIRE; NEDD1; CEP250; CEP57; STUB1; BAG4; DNAJC7; STAU1; UBC; ZBTB1; TRIM25; XPO1; RAP1GDS1; NUCB2; HSPA5; GAPDH; CLU; CAMK1D; UBQLN1; IPO7; PARK2; BAG3; HDAC6; K5; METTL21C; DCP1B; METTL21A; CFTR; METTL22; DCP1A; METTL21B; UBL4A; TRAF3
  1. What is the species homology for "HSPA1L Antibody - C-terminal region (ARP53636_P050)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig".

  2. How long will it take to receive "HSPA1L Antibody - C-terminal region (ARP53636_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HSPA1L Antibody - C-terminal region (ARP53636_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HSPA1L Antibody - C-terminal region (ARP53636_P050)"?

    This target may also be called "HSP70T, hum70t, HSP70-1L, HSP70-HOM" in publications.

  5. What is the shipping cost for "HSPA1L Antibody - C-terminal region (ARP53636_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HSPA1L Antibody - C-terminal region (ARP53636_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HSPA1L Antibody - C-terminal region (ARP53636_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "70kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HSPA1L Antibody - C-terminal region (ARP53636_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HSPA1L"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HSPA1L"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HSPA1L"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HSPA1L"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HSPA1L"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HSPA1L"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HSPA1L Antibody - C-terminal region (ARP53636_P050)
Your Rating
We found other products you might like!