Hspa1a Antibody - N-terminal region (ARP61005_P050)

Catalog No: ARP61005_P050

WB Suggested Anti-Hspa1a Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Heart

Lanes:
Lane1: 10ug mouse cortex brain lysate
Lane2: 25ug mouse cortex brain lysate
Lane3: 40ug mouse cortex brain lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-rabbit HRP
Secondary Antibody Dilution:
1:2000
Gene Name:
Hspa1a
Submitted by:
Anonymous

WB Suggested Anti-Hspa1a Antibody
Positive Control: Lane 1: 80ug pig serum
Primary Antibody Dilution : 1:1000
Secondary Antibody : Anti-rabbit-HRP
Secondry Antibody Dilution : 1:1000
Submitted by: Martina Ondrovics, University of Veterinary Medicine Vienna

WB Suggested Anti-Hspa1a Antibody
Positive Control: Lane 1: 80ug pig serum
Primary Antibody Dilution : 1:1000
Secondary Antibody : Anti-rabbit-HRP
Secondry Antibody Dilution : 1:1000
Submitted by: Martina Ondrovics, University of Veterinary Medicine Vienna

Product Info

• Tested Species Reactivity: Mouse, Pig
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Goat, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: KMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Hspa1a (ARP61005_P050) antibody is Catalog # AAP61005

Target Info

• Gene Symbol: Hspa1a
• Gene Full Name: Heat shock protein 1A
• Alias Symbols: Hsp, Hsp7, Hsp70, Hsp72, hsp68, Hsp70-3, Hsp70.3, hsp70A1
• NCBI Gene Id: 193740
• Protein Name: Heat shock 70 kDa protein 1A
• Description of Target: In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.
• Uniprot ID: Q61696
• Protein Accession #: NP_034609
• Nucleotide Accession #: NM_010479
• Protein Size (# AA): 641
• Molecular Weight: 70kDa