Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33096_T100-FITC Conjugated

ARP33096_T100-HRP Conjugated

ARP33096_T100-Biotin Conjugated

HSPA1A Antibody - middle region (ARP33096_T100)

Catalog#: ARP33096_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-1060 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HSPA1A
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data Anti-HSPA1A (ARP33096_T100)
Peptide Sequence Synthetic peptide located within the following region: SLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HSPA1A (ARP33096_T100) antibody is Catalog # AAP33096 (Previous Catalog # AAPP04129)
Datasheets/Manuals Printable datasheet for anti-HSPA1A (ARP33096_T100) antibody
Target Reference Tracey,A. Submitted (13-MAY-2005)

Narjoz, C. et al. Genomic consequences of cytochrome P450 2C9 overexpression in human hepatoma cells. Chem. Res. Toxicol. 22, 779-87 (2009). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 19445531

Gene Symbol HSPA1A
Official Gene Full Name Heat shock 70kDa protein 1A
Alias Symbols HSP72, HSPA1, HSP70I, HSPA1B, HSP70-1, HSP70-1A
NCBI Gene Id 3303
Description of Target HSPA1A is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1.
Swissprot Id P08107
Protein Accession # CAI18465
Nucleotide Accession # NM_005345
Protein Size (# AA) 476
Molecular Weight 52kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HSPA1A.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HSPA1A.
  1. What is the species homology for "HSPA1A Antibody - middle region (ARP33096_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep".

  2. How long will it take to receive "HSPA1A Antibody - middle region (ARP33096_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HSPA1A Antibody - middle region (ARP33096_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "HSPA1A Antibody - middle region (ARP33096_T100)"?

    This target may also be called "HSP72, HSPA1, HSP70I, HSPA1B, HSP70-1, HSP70-1A" in publications.

  5. What is the shipping cost for "HSPA1A Antibody - middle region (ARP33096_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HSPA1A Antibody - middle region (ARP33096_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HSPA1A Antibody - middle region (ARP33096_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HSPA1A Antibody - middle region (ARP33096_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HSPA1A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HSPA1A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HSPA1A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HSPA1A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HSPA1A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HSPA1A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HSPA1A Antibody - middle region (ARP33096_T100)
Your Rating
We found other products you might like!