Search Antibody, Protein, and ELISA Kit Solutions

HSPA1A Antibody - middle region (ARP33096_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33096_T100-FITC Conjugated

ARP33096_T100-HRP Conjugated

ARP33096_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-1060 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human HSPA1A
Purification:
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-HSPA1A (ARP33096_T100)
Peptide Sequence:
Synthetic peptide located within the following region: SLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLV
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-HSPA1A (ARP33096_T100) antibody is Catalog # AAP33096 (Previous Catalog # AAPP04129)
Datasheets/Manuals:
Printable datasheet for anti-HSPA1A (ARP33096_T100) antibody
Target Reference:
Tracey,A. Submitted (13-MAY-2005)
Publications:

Narjoz, C. et al. Genomic consequences of cytochrome P450 2C9 overexpression in human hepatoma cells. Chem. Res. Toxicol. 22, 779-87 (2009). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 19445531

Gene Symbol:
HSPA1A
Official Gene Full Name:
Heat shock 70kDa protein 1A
Alias Symbols:
HSP72, HSPA1, HSP70I, HSPA1B, HSP70-1, HSP70-1A
NCBI Gene Id:
3303
Description of Target:
HSPA1A is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1.
Swissprot Id:
P08107
Protein Accession #:
CAI18465
Nucleotide Accession #:
NM_005345
Protein Size (# AA):
476
Molecular Weight:
52kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HSPA1A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HSPA1A.
Protein Interactions:
UBC; TP53; NEDD1; HAUS1; CEP76; CEP72; HAUS2; AIRE; CEP250; TUBGCP2; TUBGCP3; SAE1; CEP57; AURKB; TUBG1; AURKA; SUMO2; TUBGCP4; PPP2R1A; LGALS3BP; EMD; CDKN1A; CDC20; SUMO3; STAU1; MDM2; TRIM25; ASB10; ASB16; WWOX; EZH2; BMI1; SUZ12; TUBA4A; EIF6; ALDOC;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...