Size:100 ul
$249.00
In Stock
SKU
ARP33096_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33096_T100-FITC Conjugated

ARP33096_T100-HRP Conjugated

ARP33096_T100-Biotin Conjugated

HSPA1A Antibody - middle region (ARP33096_T100)

Catalog#: ARP33096_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-1060 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HSPA1A
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology dataAnti-HSPA1A (ARP33096_T100)
Peptide SequenceSynthetic peptide located within the following region: SLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLV
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-HSPA1A (ARP33096_T100) antibody is Catalog # AAP33096 (Previous Catalog # AAPP04129)
Datasheets/ManualsPrintable datasheet for anti-HSPA1A (ARP33096_T100) antibody
Target ReferenceTracey,A. Submitted (13-MAY-2005)
Publications

Narjoz, C. et al. Genomic consequences of cytochrome P450 2C9 overexpression in human hepatoma cells. Chem. Res. Toxicol. 22, 779-87 (2009). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 19445531

Gene SymbolHSPA1A
Official Gene Full NameHeat shock 70kDa protein 1A
Alias SymbolsHSP72, HSPA1, HSP70I, HSPA1B, HSP70-1, HSP70-1A
NCBI Gene Id3303
Description of TargetHSPA1A is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1.
Swissprot IdP08107
Protein Accession #CAI18465
Nucleotide Accession #NM_005345
Protein Size (# AA)476
Molecular Weight52kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express HSPA1A.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express HSPA1A.
Protein InteractionsUBC; TP53; NEDD1; HAUS1; CEP76; CEP72; HAUS2; AIRE; CEP250; TUBGCP2; TUBGCP3; SAE1; CEP57; AURKB; TUBG1; AURKA; SUMO2; TUBGCP4; PPP2R1A; LGALS3BP; EMD; CDKN1A; CDC20; SUMO3; STAU1; MDM2; TRIM25; ASB10; ASB16; WWOX; EZH2; BMI1; SUZ12; TUBA4A; EIF6; ALDOC;
  1. What is the species homology for "HSPA1A Antibody - middle region (ARP33096_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep".

  2. How long will it take to receive "HSPA1A Antibody - middle region (ARP33096_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HSPA1A Antibody - middle region (ARP33096_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HSPA1A Antibody - middle region (ARP33096_T100)"?

    This target may also be called "HSP72, HSPA1, HSP70I, HSPA1B, HSP70-1, HSP70-1A" in publications.

  5. What is the shipping cost for "HSPA1A Antibody - middle region (ARP33096_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HSPA1A Antibody - middle region (ARP33096_T100)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "HSPA1A Antibody - middle region (ARP33096_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HSPA1A Antibody - middle region (ARP33096_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HSPA1A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HSPA1A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HSPA1A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HSPA1A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HSPA1A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HSPA1A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HSPA1A Antibody - middle region (ARP33096_T100)
Your Rating
Aviva Tips and Tricks
Aviva Pathways
Aviva ChIP Antibodies
Aviva Travel Grant