HSPA13 Antibody - middle region (ARP79037_P050)

Catalog No: ARP79037_P050

Host: Rabbit
Target Name: HSPA13
Sample Tissue: Human Jurkat Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSPA13
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: MVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HSPA13 (ARP79037_P050) antibody is Catalog # AAP79037

Target Info

• Gene Symbol: HSPA13
• Gene Full Name: heat shock protein family A (Hsp70) member 13
• Alias Symbols: STCH
• NCBI Gene Id: 6782
• Protein Name: heat shock 70 kDa protein 13
• Description of Target: The protein encoded by this gene is a member of the heat shock protein 70 family and is found associated with microsomes. Members of this protein family play a role in the processing of cytosolic and secretory proteins, as well as in the removal of denatured or incorrectly-folded proteins. The encoded protein contains an ATPase domain and has been shown to associate with a ubiquitin-like protein.
• Uniprot ID: P48723
• Protein Accession #: NP_008879.3
• Nucleotide Accession #: NM_006948.4
• Protein Size (# AA): 471
• Molecular Weight: 51 kDa