Catalog No: OABB01820
Size:100UG
Price: $432.00
SKU
OABB01820
Availability: Domestic: within 1-2 week delivery | International: within 1-2 week delivery
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for HSP60 Antibody (OABB01820)
Product Info
Tested Species ReactivityHuman, Mouse, Rat
Predicted Species ReactivityHuman|Mouse|Rat
Product FormatLyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
ClonalityPolyclonal
ClonePolyclonal
IsotypeRabbit IgG
HostRabbit
ApplicationImmunocytochemistry|Immunofluorescence|Immunohistochemistry|Western blot
Additional InformationNotes: WB: The detection limit for Hsp60 is approximately 0.1ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
::Background: HSP60 is a member of the chaperonin class of protein factors, which include the Escherichia coli groEL protein and the Rubisco subunit-binding protein of chloroplasts. It acts as a costimulator of human regulatory CD4-positive/CD25 -positive T cells, which inhibit lymphoproliferation and IFNG and TNF secretion by CD4-positive and CD8-positive T cells. HSP60 enhances Treg activity via TLR2, leading to activation of an intracellular signaling cascade that included p38, as well as inhibition of ERK phosphorylation. Suppression of target T cells is mediated by both cell-to-cell contact and by secretion of TGFB and IL10, and it leads to downregulation of ERK, NFKB, and TBET expression. The self-molecule HSP60 can downregulate adaptive immune responses by upregulating Tregs through TLR2 signaling.
Reconstitution and Storage2°C to 8°C|-20°C
ImmunogenE.coli-derived human Hsp60 recombinant protein (Position: A260-Q496). Human Hsp60 shares 97% amino acid (aa) sequence identity with both mouse and rat Hsp60.
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: ALEIANAHRKPLVIIAEDVDGEALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLKGKGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLIVEKIMQ
Concentration500 ug/ml
SpecificityNo cross reactivity with other proteins.
Application InfoWestern blot: 0.1-0.5 ug/ml: Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section): 0.5-1 ug/ml: Human, Mouse, Rat: By Heat
Immunocytochemistry/Immunofluorescence: 2 ug/ml: Human
Reference1. Cheng, M. Y.; Hartl, F.-U.; Martin, J.; Pollock, R. A.; Kalousek, F.; Neupert, W.; Hallberg, E. M.; Hallberg, R. L.; Horwich, A. L. : Mitochondrial heat-shock protein hsp60 is essential for assembly of proteins imported into yeast mitochondria. Nature 337: 620-625, 1989.
2. Zanin-Zhorov, A.; Cahalon, L.; Tal, G.; Margalit, R.; Lider, O.; Cohen, I. R. : Heat shock protein 60 enhances CD4+CD25+ regulatory T cell function via innate TLR2 signaling. J. Clin. Invest. 116: 2022-2032, 2006.
Storage BufferEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
DescriptionRabbit IgG polyclonal antibody for 60 kDa heat shock protein, mitochondrial(HSPD1) detection. Tested with WB, IHC-P, ICC/IF in Human;Mouse;Rat.
Gene SymbolHSPD1
Gene Full Nameheat shock protein family D (Hsp60) member 1
Alias Symbols60 kDa chaperonin;60 kDa heat shock protein, mitochondrial;chaperonin 60;CPN60;epididymis secretory sperm binding protein;GROEL;heat shock 60kDa protein 1 (chaperonin);Heat shock protein 60;heat shock protein 65;HLD4;HSP60;HSP-60;HSP65;HuCHA60;mitochondrial matrix protein P1;P60 lymphocyte protein;short heat shock protein 60 Hsp60s1;SPG13.
NCBI Gene Id3329
Protein Name60 kDa heat shock protein, mitochondrial
Description of TargetChaperonin implicated in mitochondrial protein import and macromolecular assembly. Together with Hsp10, facilitates the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded polypeptides generated under stress conditions in the mitochondrial matrix (PubMed:1346131, PubMed:11422376). The functional units of these chaperonins consist of heptameric rings of the large subunit Hsp60, which function as a back-to-back double ring. In a cyclic reaction, Hsp60 ring complexes bind one unfolded substrate protein per ring, followed by the binding of ATP and association with 2 heptameric rings of the co-chaperonin Hsp10. This leads to sequestration of the substrate protein in the inner cavity of Hsp60 where, for a certain period of time, it can fold undisturbed by other cell components. Synchronous hydrolysis of ATP in all Hsp60 subunits results in the dissociation of the chaperonin rings and the release of ADP and the folded substrate protein (Probable).
Uniprot IDP10809
Molecular Weight61055 MW
  1. What is the species homology for "HSP60 Antibody (OABB01820)"?

    The tested species reactivity for this item is "Human, Mouse, Rat". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "HSP60 Antibody (OABB01820)"?

    This item is available "Domestic: within 1-2 week delivery | International: within 1-2 week delivery".

  3. What buffer format is "HSP60 Antibody (OABB01820)" provided in?

    This item is provided in "Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HSP60 Antibody (OABB01820)"?

    This target may also be called "60 kDa chaperonin;60 kDa heat shock protein, mitochondrial;chaperonin 60;CPN60;epididymis secretory sperm binding protein;GROEL;heat shock 60kDa protein 1 (chaperonin);Heat shock protein 60;heat shock protein 65;HLD4;HSP60;HSP-60;HSP65;HuCHA60;mitochondrial matrix protein P1;P60 lymphocyte protein;short heat shock protein 60 Hsp60s1;SPG13." in publications.

  5. What is the shipping cost for "HSP60 Antibody (OABB01820)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HSP60 Antibody (OABB01820)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HSP60 Antibody (OABB01820)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "61055 MW".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HSP60 Antibody (OABB01820)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HSPD1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HSPD1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HSPD1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HSPD1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HSPD1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HSPD1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HSP60 Antibody (OABB01820)
Your Rating