Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP47544_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP47544_P050-FITC Conjugated

ARP47544_P050-HRP Conjugated

ARP47544_P050-Biotin Conjugated

HSF5 Antibody - middle region (ARP47544_P050)

Catalog#: ARP47544_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityDog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-103552 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HSF5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology dataAnti-HSF5 (ARP47544_P050)
Peptide SequenceSynthetic peptide located within the following region: SKPSEDTGLATPARYREHRSNSQQGKSPDLHLLVDVACKQERFPKEEELK
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-HSF5 (ARP47544_P050) antibody is Catalog # AAP47544 (Previous Catalog # AAPS22207)
Datasheets/ManualsPrintable datasheet for anti-HSF5 (ARP47544_P050) antibody
Publications

Xu, Y.-M., Huang, D.-Y., Chiu, J.-F. & Lau, A. T. Y. Post-translational modification of human heat shock factors and their functions: a recent update by proteomic approach. J. Proteome Res. 11, 2625-34 (2012). WB, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 22494029

Gene SymbolHSF5
Official Gene Full NameHeat shock transcription factor family member 5
Alias SymbolsFLJ40311, MGC134827, HSF 5, HSTF 5
NCBI Gene Id124535
Protein NameHeat shock factor protein 5
Description of TargetHSF5 may act as a transcriptional factor.
Swissprot IdQ4G112
Protein Accession #NP_001073908
Nucleotide Accession #NM_001080439
Protein Size (# AA)596
Molecular Weight65kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express HSF5.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express HSF5.
Protein InteractionsSAMHD1; ACTN1;
  1. What is the species homology for "HSF5 Antibody - middle region (ARP47544_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "HSF5 Antibody - middle region (ARP47544_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HSF5 Antibody - middle region (ARP47544_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HSF5 Antibody - middle region (ARP47544_P050)"?

    This target may also be called "FLJ40311, MGC134827, HSF 5, HSTF 5" in publications.

  5. What is the shipping cost for "HSF5 Antibody - middle region (ARP47544_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HSF5 Antibody - middle region (ARP47544_P050)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "HSF5 Antibody - middle region (ARP47544_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "65kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HSF5 Antibody - middle region (ARP47544_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HSF5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HSF5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HSF5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HSF5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HSF5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HSF5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HSF5 Antibody - middle region (ARP47544_P050)
Your Rating
Aviva Pathways
Aviva Travel Grant
Aviva HIS tag Deal
Aviva ChIP Antibodies