Search Antibody, Protein, and ELISA Kit Solutions

HSF5 antibody - middle region (ARP47544_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP47544_P050-FITC Conjugated

ARP47544_P050-HRP Conjugated

ARP47544_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Heat shock transcription factor family member 5
Protein Name:
Heat shock factor protein 5
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ40311, MGC134827, HSF 5, HSTF 5
Replacement Item:
This antibody may replace item sc-103552 from Santa Cruz Biotechnology.
Description of Target:
HSF5 may act as a transcriptional factor.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HSF5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HSF5.
The immunogen is a synthetic peptide directed towards the middle region of human HSF5
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-HSF5 (ARP47544_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SKPSEDTGLATPARYREHRSNSQQGKSPDLHLLVDVACKQERFPKEEELK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HSF5 (ARP47544_P050) antibody is Catalog # AAP47544 (Previous Catalog # AAPS22207)
Printable datasheet for anti-HSF5 (ARP47544_P050) antibody

Xu, Y.-M., Huang, D.-Y., Chiu, J.-F. & Lau, A. T. Y. Post-translational modification of human heat shock factors and their functions: a recent update by proteomic approach. J. Proteome Res. 11, 2625-34 (2012). WB, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 22494029

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...