HSF4 Antibody - middle region (ARP32652_T100)

Catalog No: ARP32652_T100

WB Suggested Anti-HSF4 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSF4
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Rabbit: 92%
• Peptide Sequence: Synthetic peptide located within the following region: VTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSLMLDEGSSCPT
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-HSF4 (ARP32652_T100) antibody is Catalog # AAP32652 (Previous Catalog # AAPP03662)
• Reference: Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65

Target Info

• Gene Symbol: HSF4
• Gene Full Name: Heat shock transcription factor 4
• Alias Symbols: CTM, CTRCT5
• NCBI Gene Id: 3299
• Protein Name: Heat shock factor protein 4
• Description of Target: Heat-shock transcription factors (HSFs) activate heat-shock response genes under conditions of heat or other stresses. HSF4 lacks the carboxyl-terminal hydrophobic repeat which is shared among all vertebrate HSFs and has been suggested to be involved in the negative regulation of DNA binding activity. Two alternatively spliced transcripts encoding distinct isoforms and possessing different transcriptional activity have been described.
• Uniprot ID: Q9ULV5-2
• Protein Accession #: NP_001529
• Nucleotide Accession #: NM_001538
• Protein Size (# AA): 463
• Molecular Weight: 50kDa
• Protein Interactions: SESTD1; MYO15A; TIMM13; SUGT1; RABEP1; TARBP1; HSF2; HSF1; FKBP5; DUSP26; MAPK1; SUMO1; ZBED8; NUDT21; CDK2AP2; BCL6; SMARCA4; SLC27A5; HSF4; MAPK3; MAPK8; MAPK14;