Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP41821_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41821_P050-FITC Conjugated

ARP41821_P050-HRP Conjugated

ARP41821_P050-Biotin Conjugated

HSD3B1 Antibody - N-terminal region (ARP41821_P050)

Rating:
90% of 100
Catalog#: ARP41821_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human, Monkey
Predicted Species Reactivity Goat, Human, Monkey
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-100466 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HSD3B1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Goat: 82%; Human: 100%; Monkey: 92%
Complete computational species homology data Anti-HSD3B1 (ARP41821_P050)
Peptide Sequence Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HSD3B1 (ARP41821_P050) antibody is Catalog # AAP41821 (Previous Catalog # AAPP10869)
Datasheets/Manuals Printable datasheet for anti-HSD3B1 (ARP41821_P050) antibody
Target Reference Ross,R.W., (2008) J. Clin. Oncol. 26 (6), 842-847
Publications

Mirkheshti, N; Park, S; Jiang, S; Cropper, J; Werner, SL; Song, CS; Chatterjee, B; Dual targeting of androgen receptor and mTORC1 by salinomycin in prostate cancer. 7, 62240-62254 (2016). WB, Cow, Goat, Horse, Human, Pig, Rat, Sheep, Monkey 27557496

Gene Symbol HSD3B1
Official Gene Full Name Hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
Alias Symbols HSD3B, HSDB3, I, HSDB3A, SDR11E1, 3BETAHSD
NCBI Gene Id 3283
Protein Name 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
Description of Target 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.
Swissprot Id P14060
Protein Accession # NP_000853
Nucleotide Accession # NM_000862
Protein Size (# AA) 373
Molecular Weight 42kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HSD3B1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HSD3B1.
Write Your Own Review
You're reviewing:HSD3B1 Antibody - N-terminal region (ARP41821_P050)
Your Rating