Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP41821_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41821_P050-FITC Conjugated

ARP41821_P050-HRP Conjugated

ARP41821_P050-Biotin Conjugated

HSD3B1 Antibody - N-terminal region (ARP41821_P050)

Rating:
90% of 100
Catalog#: ARP41821_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Monkey
Predicted Species Reactivity Goat, Human, Monkey
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-100466 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HSD3B1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Goat: 82%; Human: 100%; Monkey: 92%
Complete computational species homology data Anti-HSD3B1 (ARP41821_P050)
Peptide Sequence Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HSD3B1 (ARP41821_P050) antibody is Catalog # AAP41821 (Previous Catalog # AAPP10869)
Datasheets/Manuals Printable datasheet for anti-HSD3B1 (ARP41821_P050) antibody
Target Reference Ross,R.W., (2008) J. Clin. Oncol. 26 (6), 842-847
Publications

Mirkheshti, N; Park, S; Jiang, S; Cropper, J; Werner, SL; Song, CS; Chatterjee, B; Dual targeting of androgen receptor and mTORC1 by salinomycin in prostate cancer. 7, 62240-62254 (2016). WB, Cow, Goat, Horse, Human, Pig, Rat, Sheep, Monkey 27557496

Gene Symbol HSD3B1
Official Gene Full Name Hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
Alias Symbols HSD3B, HSDB3, I, HSDB3A, SDR11E1, 3BETAHSD
NCBI Gene Id 3283
Protein Name 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
Description of Target 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.
Swissprot Id P14060
Protein Accession # NP_000853
Nucleotide Accession # NM_000862
Protein Size (# AA) 373
Molecular Weight 42kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HSD3B1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HSD3B1.
  1. What is the species homology for "HSD3B1 Antibody - N-terminal region (ARP41821_P050)"?

    The tested species reactivity for this item is "Human, Monkey". This antibody is predicted to have homology to "Goat, Human, Monkey".

  2. How long will it take to receive "HSD3B1 Antibody - N-terminal region (ARP41821_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HSD3B1 Antibody - N-terminal region (ARP41821_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HSD3B1 Antibody - N-terminal region (ARP41821_P050)"?

    This target may also be called "HSD3B, HSDB3, I, HSDB3A, SDR11E1, 3BETAHSD" in publications.

  5. What is the shipping cost for "HSD3B1 Antibody - N-terminal region (ARP41821_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HSD3B1 Antibody - N-terminal region (ARP41821_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HSD3B1 Antibody - N-terminal region (ARP41821_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HSD3B1 Antibody - N-terminal region (ARP41821_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HSD3B1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HSD3B1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HSD3B1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HSD3B1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HSD3B1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HSD3B1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HSD3B1 Antibody - N-terminal region (ARP41821_P050)
Your Rating
We found other products you might like!