SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP62143_P050
Price: $0.00
SKU
ARP62143_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-HSD17B8 (ARP62143_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: TVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVV
Concentration0.5 mg/ml
Blocking PeptideFor anti-HSD17B8 (ARP62143_P050) antibody is Catalog # AAP62143
Sample Type Confirmation

HSD17B8 is supported by BioGPS gene expression data to be expressed in RPMI 8226

Gene SymbolHSD17B8
Gene Full NameHydroxysteroid (17-beta) dehydrogenase 8
Alias SymbolsKE6, FABG, HKE6, FABGL, RING2, H2-KE6, SDR30C1, D6S2245E, dJ1033B10.9
NCBI Gene Id7923
Protein NameEstradiol 17-beta-dehydrogenase 8
Description of TargetIn mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosterone. However, the enzyme has some reductive activity and can synthesize estradiol from estrone. The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An alternatively spliced transcript of this gene has been detected, but the full-length nature of this variant has not been determined.
Uniprot IDQ92506
Protein Accession #NP_055049
Nucleotide Accession #NM_014234
Protein Size (# AA)261
Molecular Weight29kDa
Protein InteractionsRAD21;
  1. What is the species homology for "HSD17B8 Antibody - N-terminal region (ARP62143_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "HSD17B8 Antibody - N-terminal region (ARP62143_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HSD17B8 Antibody - N-terminal region (ARP62143_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HSD17B8 Antibody - N-terminal region (ARP62143_P050)"?

    This target may also be called "KE6, FABG, HKE6, FABGL, RING2, H2-KE6, SDR30C1, D6S2245E, dJ1033B10.9" in publications.

  5. What is the shipping cost for "HSD17B8 Antibody - N-terminal region (ARP62143_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HSD17B8 Antibody - N-terminal region (ARP62143_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HSD17B8 Antibody - N-terminal region (ARP62143_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "29kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HSD17B8 Antibody - N-terminal region (ARP62143_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HSD17B8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HSD17B8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HSD17B8"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HSD17B8"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HSD17B8"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HSD17B8"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HSD17B8 Antibody - N-terminal region (ARP62143_P050)
Your Rating