Size:100 ul
$249.00
In Stock
SKU
ARP41529_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41529_T100-FITC Conjugated

ARP41529_T100-HRP Conjugated

ARP41529_T100-Biotin Conjugated

HSD17B6 Antibody - N-terminal region (ARP41529_T100)

Catalog#: ARP41529_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101878 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HSD17B6
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%
Complete computational species homology data Anti-HSD17B6 (ARP41529_T100)
Peptide Sequence Synthetic peptide located within the following region: MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HSD17B6 (ARP41529_T100) antibody is Catalog # AAP41529 (Previous Catalog # AAPP24215)
Datasheets/Manuals Printable datasheet for anti-HSD17B6 (ARP41529_T100) antibody
Sample Type Confirmation

HSD17B6 is strongly supported by BioGPS gene expression data to be expressed in A172

Target Reference Huang,X.F. (2001) Biochim. Biophys. Acta 1520 (2), 124-130
Publications

Mohler, J. L. et al. Activation of the androgen receptor by intratumoral bioconversion of androstanediol to dihydrotestosterone in prostate cancer. Cancer Res. 71, 1486-96 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21303972

Muthusamy, S. et al. Estrogen receptor b and 17b-hydroxysteroid dehydrogenase type 6, a growth regulatory pathway that is lost in prostate cancer. Proc. Natl. Acad. Sci. U. S. A. 108, 20090-4 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22114194

Gene Symbol HSD17B6
Official Gene Full Name Hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse)
Alias Symbols HSE, RODH, SDR9C6
NCBI Gene Id 8630
Protein Name 17-beta-hydroxysteroid dehydrogenase type 6
Description of Target HSD17B6 has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. HSD17B6 is a member of the retinol dehydrogenase family.The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. Transcript variants utilizing alternative polyadenylation signals exist.
Swissprot Id O14756
Protein Accession # NP_003716
Nucleotide Accession # NM_003725
Protein Size (# AA) 317
Molecular Weight 35kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HSD17B6.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HSD17B6.
  1. What is the species homology for "HSD17B6 Antibody - N-terminal region (ARP41529_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "HSD17B6 Antibody - N-terminal region (ARP41529_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HSD17B6 Antibody - N-terminal region (ARP41529_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HSD17B6 Antibody - N-terminal region (ARP41529_T100)"?

    This target may also be called "HSE, RODH, SDR9C6" in publications.

  5. What is the shipping cost for "HSD17B6 Antibody - N-terminal region (ARP41529_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HSD17B6 Antibody - N-terminal region (ARP41529_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HSD17B6 Antibody - N-terminal region (ARP41529_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HSD17B6 Antibody - N-terminal region (ARP41529_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HSD17B6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HSD17B6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HSD17B6"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HSD17B6"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HSD17B6"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HSD17B6"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HSD17B6 Antibody - N-terminal region (ARP41529_T100)
Your Rating