Search Antibody, Protein, and ELISA Kit Solutions

HSD17B6 Antibody - N-terminal region (ARP41529_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41529_T100-FITC Conjugated

ARP41529_T100-HRP Conjugated

ARP41529_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse)
NCBI Gene Id:
Protein Name:
17-beta-hydroxysteroid dehydrogenase type 6
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-101878 from Santa Cruz Biotechnology.
Description of Target:
HSD17B6 has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. HSD17B6 is a member of the retinol dehydrogenase family.The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. Transcript variants utilizing alternative polyadenylation signals exist.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HSD17B6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HSD17B6.
The immunogen is a synthetic peptide directed towards the N terminal region of human HSD17B6
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%
Complete computational species homology data:
Anti-HSD17B6 (ARP41529_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-HSD17B6 (ARP41529_T100) antibody is Catalog # AAP41529 (Previous Catalog # AAPP24215)
Printable datasheet for anti-HSD17B6 (ARP41529_T100) antibody
Sample Type Confirmation:

HSD17B6 is strongly supported by BioGPS gene expression data to be expressed in A172

Target Reference:
Huang,X.F. (2001) Biochim. Biophys. Acta 1520 (2), 124-130

Mohler, J. L. et al. Activation of the androgen receptor by intratumoral bioconversion of androstanediol to dihydrotestosterone in prostate cancer. Cancer Res. 71, 1486-96 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21303972

Muthusamy, S. et al. Estrogen receptor b and 17b-hydroxysteroid dehydrogenase type 6, a growth regulatory pathway that is lost in prostate cancer. Proc. Natl. Acad. Sci. U. S. A. 108, 20090-4 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22114194

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...