Size:100 ul
$249.00
In stock
SKU
ARP41529_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41529_T100-FITC Conjugated

ARP41529_T100-HRP Conjugated

ARP41529_T100-Biotin Conjugated

HSD17B6 Antibody - N-terminal region (ARP41529_T100)

Catalog#: ARP41529_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-101878 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HSD17B6
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%
Complete computational species homology dataAnti-HSD17B6 (ARP41529_T100)
Peptide SequenceSynthetic peptide located within the following region: MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-HSD17B6 (ARP41529_T100) antibody is Catalog # AAP41529 (Previous Catalog # AAPP24215)
Datasheets/ManualsPrintable datasheet for anti-HSD17B6 (ARP41529_T100) antibody
Sample Type Confirmation

HSD17B6 is strongly supported by BioGPS gene expression data to be expressed in A172

Target ReferenceHuang,X.F. (2001) Biochim. Biophys. Acta 1520 (2), 124-130
Publications

Mohler, J. L. et al. Activation of the androgen receptor by intratumoral bioconversion of androstanediol to dihydrotestosterone in prostate cancer. Cancer Res. 71, 1486-96 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21303972

Muthusamy, S. et al. Estrogen receptor b and 17b-hydroxysteroid dehydrogenase type 6, a growth regulatory pathway that is lost in prostate cancer. Proc. Natl. Acad. Sci. U. S. A. 108, 20090-4 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22114194

Gene SymbolHSD17B6
Official Gene Full NameHydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse)
Alias SymbolsHSE, RODH, SDR9C6
NCBI Gene Id8630
Protein Name17-beta-hydroxysteroid dehydrogenase type 6
Description of TargetHSD17B6 has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. HSD17B6 is a member of the retinol dehydrogenase family.The protein encoded by this gene has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. This gene is a member of the retinol dehydrogenase family. Transcript variants utilizing alternative polyadenylation signals exist.
Swissprot IdO14756
Protein Accession #NP_003716
Nucleotide Accession #NM_003725
Protein Size (# AA)317
Molecular Weight35kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express HSD17B6.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express HSD17B6.
Write Your Own Review
You're reviewing:HSD17B6 Antibody - N-terminal region (ARP41529_T100)
Your Rating
Aviva Tips and Tricks
Aviva Tissue Tool
Aviva Live Chat
Aviva Pathways