Catalog No: OPCA04026
Price: $0.00
SKU
OPCA04026
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for HSD17B14 Recombinant Protein (Human) (OPCA04026) (OPCA04026) |
---|
Predicted Species Reactivity | Homo sapiens|Human |
---|---|
Product Format | Liquid or Lyophilized powder |
Additional Information | Species Specificity Detail: Homo sapiens (Human) |
Reconstitution and Storage | -20°C or -80°C |
Formulation | Tris-base, 50% glycerol |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS |
Protein Sequence | MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 1-270 aa |
Tag | N-terminal 6xHis-SUMO-tagged |
Reference | Structural and biochemical characterization of human orphan DHRS10 reveals a novel cytosolic enzyme with steroid dehydrogenase activity.Lukacik P., Keller B., Bunkoczi G., Kavanagh K., Hwa Lee W., Adamski J., Oppermann U.Biochem. J. 402:419-427(2007) |
Gene Symbol | HSD17B14 |
---|---|
Gene Full Name | hydroxysteroid 17-beta dehydrogenase 14 |
Alias Symbols | 17-beta-HSD 14;17-beta-hydroxysteroid dehydrogenase 14;17-beta-hydroxysteroid dehydrogenase DHRS10;dehydrogenase/reductase (SDR family) member 10;Dehydrogenase/reductase SDR family member 10;DHRS10;retinal short-chain dehydrogenase/reductase 3;retinal short-chain dehydrogenase/reductase retSDR3;retSDR3;SDR47C1;short chain dehydrogenase/reductase family 47C member 1;testicular tissue protein Li 52. |
NCBI Gene Id | 51171 |
Protein Name | 17-beta-hydroxysteroid dehydrogenase 14 |
Description of Target | Has NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity. Converts oestradiol to oestrone. The physiological substrate is not known. Acts on oestradiol and 5-androstene-3-beta,17-beta-diol (in vitro). |
Uniprot ID | Q9BPX1 |
Protein Accession # | NP_057330 |
Nucleotide Accession # | NM_016246 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 44.3 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!