HSD17B12 Antibody - C-terminal region (ARP74576_P050)

Catalog No: ARP74576_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: DHB12
Sample Type: Fetal Liver lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human DHB12
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: KTVGLQSRTNGYLIHALMGSIISNLPSWIYLKIVMNMNKSTRAHYLKKTK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HSD17B12 (ARP74576_P050) antibody is Catalog # AAP74576

Target Info

• Gene Symbol: HSD17B12
• Gene Full Name: hydroxysteroid 17-beta dehydrogenase 12
• Alias Symbols: KAR, SDR12C1
• NCBI Gene Id: 51144
• Protein Name: very-long-chain 3-oxoacyl-CoA reductase
• Description of Target: This gene encodes a very important 17beta-hydroxysteroid dehydrogenase (17beta-HSD) that converts estrone into estradiol in ovarian tissue. This enzyme is also involved in fatty acid elongation.
• Uniprot ID: Q53GQ0
• Protein Accession #: NP_057226
• Protein Size (# AA): 312
• Molecular Weight: 34kDa
• Protein Interactions: UBQLN1; UBC; RNF2; HECW2; ELOVL1; CERS2; EGFR; ADRB2; CLN3; HDAC11; MMS19; vpu; UBL4A; UBD;