HSD17B10 Recombinant Protein (Human) (OPCA04030)

Catalog No: OPCA04030

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Reconstitution and Storage: -20°C or -80°C
• Purification: Affinity purified using IMAC
• Concentration: Varies by lot. See vial for concentration.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: AAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP
• Protein Sequence: AAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 2-261 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: An intracellular protein that binds amyloid-beta peptide and mediates neurotoxicity in Alzheimer's disease.Yan S.D., Fu J., Soto C., Chen X., Zhu H., Al-Mohanna F., Collinson K., Zhu A., Stern E., Saido T., Tohyama M., Ogawa S., Roher A., Stern D.Nature 389:689-695(1997)

Target Info

• Gene Symbol: HSD17B10
• Gene Full Name: hydroxysteroid 17-beta dehydrogenase 10
• Alias Symbols: 17-beta-hydroxysteroid dehydrogenase 10;17b-HSD10;2-methyl-3-hydroxybutyryl-CoA dehydrogenase;3-hydroxy-2-methylbutyryl-CoA dehydrogenase;3-hydroxyacyl-CoA dehydrogenase type II;3-hydroxyacyl-CoA dehydrogenase type-2;ABAD;AB-binding alcohol dehydrogenase;amyloid-beta peptide binding alcohol dehydrogenase;CAMR;DUPXp11.22;endoplasmic reticulum-associated amyloid beta-peptide-binding protein;ERAB;HADH2;HCD2;HSD10MD;MHBD;mitochondrial ribonuclease P protein 2;mitochondrial RNase P subunit 2;MRPP2;MRX17;MRX31;MRXS10;SCHAD;SDR5C1;Short chain dehydrogenase/reductase family 5C member 1;short chain L-3-hydroxyacyl-CoA dehydrogenase type 2;short chain type dehydrogenase/reductase XH98G2;Short-chain type dehydrogenase/reductase XH98G2;Type II HADH.
• NCBI Gene Id: 3028
• Protein Name: 3-hydroxyacyl-CoA dehydrogenase type-2
• Description of Target: Mitochondrial dehydrogenase that catalyzes the beta-oxidation at position 17 of androgens and estrogens and has 3-alpha-hydroxysteroid dehydrogenase activity with androsterone (PubMed:9553139, PubMed:23042678, PubMed:12917011, PubMed:18996107, PubMed:25925575, PubMed:28888424). Catalyzes the third step in the beta-oxidation of fatty acids (PubMed:9553139, PubMed:12917011, PubMed:18996107, PubMed:25925575, PubMed:28888424). Carries out oxidative conversions of 7-alpha-OH and 7-beta-OH bile acids (PubMed:12917011). Also exhibits 20-beta-OH and 21-OH dehydrogenase activities with C21 steroids (PubMed:12917011). By interacting with intracellular amyloid-beta, it may contribute to the neuronal dysfunction associated with Alzheimer disease (AD) (PubMed:9338779). Essential for structural and functional integrity of mitochondria (PubMed:20077426).
• Uniprot ID: Q99714
• Protein Accession #: NP_001032900
• Nucleotide Accession #: NM_001037811
• Protein Size (# AA): Recombinant
• Molecular Weight: 42.8 kDa