SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP45714_P050
Price: $0.00
SKU
ARP45714_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-HSD11B1 (ARP45714_P050) antibody
Product Info
Tested Species ReactivityHuman, Rat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Western analysis of fetal liver lysate.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HSD11B1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%
Peptide SequenceSynthetic peptide located within the following region: QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI
Concentration0.5 mg/ml
Blocking PeptideFor anti-HSD11B1 (ARP45714_P050) antibody is Catalog # AAP45714 (Previous Catalog # AAPP11847)
ReferencePaulsen,S.K., (2008) Obesity (Silver Spring) 16 (4), 731-735
Publications

Kuroda, K. et al. Induction of 11beta-HSD 1 and activation of distinct mineralocorticoid receptor- and glucocorticoid receptor-dependent gene networks in decidualizing human endometrial stromal cells. Mol. Endocrinol. 27, 192-202 (2013). 23275455

Lei, K. et al. Progesterone acts via the nuclear glucocorticoid receptor to suppress IL-1beta-induced COX-2 expression in human term myometrial cells. PLoS One 7, e50167 (2012). 23209664

Gene SymbolHSD11B1
Gene Full NameHydroxysteroid (11-beta) dehydrogenase 1
Alias SymbolsHDL, 11-DH, HSD11, HSD11B, HSD11L, CORTRD2, SDR26C1, 11-beta-HSD1
NCBI Gene Id3290
Protein NameCorticosteroid 11-beta-dehydrogenase isozyme 1
Description of TargetHSD11B1 is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, HSD11B1 can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children.The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Two transcript variants encoding the same protein have been found for this gene.
Uniprot IDP28845
Protein Accession #NP_005516
Nucleotide Accession #NM_005525
Protein Size (# AA)292
Molecular Weight32kDa
Protein InteractionsGKAP1; CD36;
  1. What is the species homology for "HSD11B1 Antibody - N-terminal region (ARP45714_P050)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep".

  2. How long will it take to receive "HSD11B1 Antibody - N-terminal region (ARP45714_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HSD11B1 Antibody - N-terminal region (ARP45714_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HSD11B1 Antibody - N-terminal region (ARP45714_P050)"?

    This target may also be called "HDL, 11-DH, HSD11, HSD11B, HSD11L, CORTRD2, SDR26C1, 11-beta-HSD1" in publications.

  5. What is the shipping cost for "HSD11B1 Antibody - N-terminal region (ARP45714_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HSD11B1 Antibody - N-terminal region (ARP45714_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HSD11B1 Antibody - N-terminal region (ARP45714_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "32kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HSD11B1 Antibody - N-terminal region (ARP45714_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HSD11B1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HSD11B1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HSD11B1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HSD11B1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HSD11B1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HSD11B1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HSD11B1 Antibody - N-terminal region (ARP45714_P050)
Your Rating
We found other products you might like!