Search Antibody, Protein, and ELISA Kit Solutions

HSD11B1 antibody - N-terminal region (ARP45714_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45714_P050-FITC Conjugated

ARP45714_P050-HRP Conjugated

ARP45714_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Hydroxysteroid (11-beta) dehydrogenase 1
Protein Name:
Corticosteroid 11-beta-dehydrogenase isozyme 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
11-DH, 11-beta-HSD1, HDL, HSD11, HSD11B, HSD11L, MGC13539, SDR26C1
Replacement Item:
This antibody may replace item sc-19257 from Santa Cruz Biotechnology.
Description of Target:
HSD11B1 is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, HSD11B1 can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children.The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Two transcript variants encoding the same protein have been found for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HSD11B1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HSD11B1.
The immunogen is a synthetic peptide directed towards the N terminal region of human HSD11B1
Tested Species Reactivity:
Human, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%
Complete computational species homology data:
Anti-HSD11B1 (ARP45714_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GKAP1; CD36;
Blocking Peptide:
For anti-HSD11B1 (ARP45714_P050) antibody is Catalog # AAP45714 (Previous Catalog # AAPP11847)
Printable datasheet for anti-HSD11B1 (ARP45714_P050) antibody
Additional Information:
IHC Information: Western analysis of fetal liver lysate.
Target Reference:
Paulsen,S.K., (2008) Obesity (Silver Spring) 16 (4), 731-735

Lei, K. et al. Progesterone acts via the nuclear glucocorticoid receptor to suppress IL-1β-induced COX-2 expression in human term myometrial cells. PLoS One 7, e50167 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 23209664

Kuroda, K. et al. Induction of 11β-HSD 1 and activation of distinct mineralocorticoid receptor- and glucocorticoid receptor-dependent gene networks in decidualizing human endometrial stromal cells. Mol. Endocrinol. 27, 192-202 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 23275455

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...