Search Antibody, Protein, and ELISA Kit Solutions

HSD11B1 Antibody - N-terminal region (ARP45714_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45714_P050-FITC Conjugated

ARP45714_P050-HRP Conjugated

ARP45714_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Rat
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Additional Information:
IHC Information: Western analysis of fetal liver lysate.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-19257 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human HSD11B1
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%
Complete computational species homology data:
Anti-HSD11B1 (ARP45714_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-HSD11B1 (ARP45714_P050) antibody is Catalog # AAP45714 (Previous Catalog # AAPP11847)
Printable datasheet for anti-HSD11B1 (ARP45714_P050) antibody
Target Reference:
Paulsen,S.K., (2008) Obesity (Silver Spring) 16 (4), 731-735

Kuroda, K. et al. Induction of 11b-HSD 1 and activation of distinct mineralocorticoid receptor- and glucocorticoid receptor-dependent gene networks in decidualizing human endometrial stromal cells. Mol. Endocrinol. 27, 192-202 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 23275455

Lei, K. et al. Progesterone acts via the nuclear glucocorticoid receptor to suppress IL-1b-induced COX-2 expression in human term myometrial cells. PLoS One 7, e50167 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 23209664

Gene Symbol:
Official Gene Full Name:
Hydroxysteroid (11-beta) dehydrogenase 1
Alias Symbols:
11-DH, 11-beta-HSD1, HDL, HSD11, HSD11B, HSD11L, MGC13539, SDR26C1
NCBI Gene Id:
Protein Name:
Corticosteroid 11-beta-dehydrogenase isozyme 1
Description of Target:
HSD11B1 is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, HSD11B1 can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children.The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Two transcript variants encoding the same protein have been found for this gene.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HSD11B1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HSD11B1.
Protein Interactions:
GKAP1; CD36;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...