Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

HRK Antibody - N-terminal region (ARP46364_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46364_P050-FITC Conjugated

ARP46364_P050-HRP Conjugated

ARP46364_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Harakiri, BCL2 interacting protein (contains only BH3 domain)
NCBI Gene Id:
Protein Name:
Activator of apoptosis harakiri
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-26825 from Santa Cruz Biotechnology.
Description of Target:
Activator of apoptosis Hrk regulates apoptosis through interaction with death-repressor proteins Bcl-2 and Bcl-X(L). The HRK protein lacks significant homology to other BCL2 family members except for an 8-amino acid region that was similar to the BCL2 hom
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HRK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HRK.
The immunogen is a synthetic peptide directed towards the N terminal region of human HRK
Predicted Species Reactivity:
Cow, Dog, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 83%; Rabbit: 100%; Rat: 83%
Complete computational species homology data:
Anti-HRK (ARP46364_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMW
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HRK (ARP46364_P050) antibody is Catalog # AAP46364 (Previous Catalog # AAPP27150)
Printable datasheet for anti-HRK (ARP46364_P050) antibody

Lucas, CM; Milani, M; Butterworth, M; Carmell, N; Scott, LJ; Clark, RE; Cohen, GM; Varadarajan, S; High CIP2A levels correlate with an antiapoptotic phenotype that can be overcome by targeting BCL-XL in chronic myeloid leukemia. 30, 1273-81 (2016). WB, Cow, Dog, Human, Mouse, Rabbit, Rat 26987906

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...