HRH1 Antibody (OAAL00150)

Catalog No: OAAL00150

Size:100UG

Detection limit for recombinant GST tagged HRH1 is 0.1 ng/ml as a capture antibody.

Proximity Ligation Analysis of protein-protein interactions between IL6 and HRH1. HeLa cells were stained with anti-IL6 rabbit purified polyclonal 1:1200 and anti-HRH1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 3D1
• Isotype: IgG1 Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Proximity ligation assay
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: HRH1 (NP_000852.1, 312 a.a. ~ 414 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: AAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAA
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: HRH1
• Gene Full Name: histamine receptor H1
• Alias Symbols: H1R;H1-R;HH1R;hisH1;histamine H1 receptor;histamine receptor, subclass H1.
• NCBI Gene Id: 3269
• Protein Name: histamine H1 receptor [Homo sapiens]|Homo sapiens histamine receptor H1 (HRH1), transcript variant 4, mRNA
• Description of Target: Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. This gene was thought to be intronless until recently. The protein encoded by this gene is an integral membrane protein and belongs to the G protein-coupled receptor superfamily. It mediates the contraction of smooth muscles, the increase in capillary permeability due to contraction of terminal venules, the release of catecholamine from adrenal medulla, and neurotransmission in the central nervous system. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/NP_000852.1
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/NM_000861