HRH1 Antibody - middle region (ARP64612_P050)

Catalog No: ARP64612_P050

WB Suggested Anti-HRH1 Antibody
Titration: 1.0 ug/ml
Positive Control: Hela Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Dog, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 86%; Human: 100%; Pig: 79%; Rabbit: 79%
• Peptide Sequence: Synthetic peptide located within the following region: ENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HRH1 (ARP64612_P050) antibody is Catalog # AAP64612

Target Info

• Gene Symbol: HRH1
• Gene Full Name: Histamine receptor H1
• Alias Symbols: H1R, H1-R, HH1R, hisH1
• NCBI Gene Id: 3269
• Protein Name: Histamine H1 receptor
• Description of Target: Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. This gene was thought to be intronless until recently. The protein encoded by this gene is an integral membrane protein and belongs to the G protein-coupled receptor superfamily. It mediates the contraction of smooth muscles, the increase in capillary permeability due to contraction of terminal venules, the release of catecholamine from adrenal medulla, and neurotransmission in the central nervous system. Multiple alternatively spliced variants, encoding the same protein, have been identified.
• Uniprot ID: P35367
• Protein Accession #: NP_000852
• Nucleotide Accession #: NM_000861
• Protein Size (# AA): 487
• Molecular Weight: 56kDa
• Protein Interactions: UBC;