HRH1 Antibody - C-terminal region (ARP64611_P050)

Catalog No: ARP64611_P050

Host: Rabbit
Target Name: HRH1
Sample Tissue: Human Leiomyosarcoma lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HRH1
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SSWPSPTEPSSKSGNLRHLHILIGTSVVKIPFTILLFFLLHRWCSNKKKC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HRH1 (ARP64611_P050) antibody is Catalog # AAP64611

Target Info

• Gene Symbol: HRH1
• Gene Full Name: histamine receptor H1
• Alias Symbols: H1R, H1-R, HH1R, hisH1
• NCBI Gene Id: 3269
• Protein Name: histamine H1 receptor
• Description of Target: Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by histamine receptors H1, H2, H3 and H4. The protein encoded by this gene is an integral membrane protein and belongs to the G protein-coupled receptor superfamily. It mediates the contraction of smooth muscles, the increase in capillary permeability due to contraction of terminal venules, the release of catecholamine from adrenal medulla, and neurotransmission in the central nervous system. It has been associated with multiple processes, including memory and learning, circadian rhythm, and thermoregulation. It is also known to contribute to the pathophysiology of allergic diseases such as atopic dermatitis, asthma, anaphylaxis and allergic rhinitis. Multiple alternatively spliced variants, encoding the same protein, have been identified.
• Uniprot ID: P35367
• Protein Accession #: NP_000852
• Nucleotide Accession #: NM_000861.3
• Protein Size (# AA): 487
• Molecular Weight: 56 kDa
• Protein Interactions: UBC;