HRB Antibody - middle region (ARP40520_P050)

Catalog No: ARP40520_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-HRB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysateAGFG1 is supported by BioGPS gene expression data to be expressed in HepG2

Host: Rabbit
Target Name: AGFG1
Sample Type: Human Fetal Muscle
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: AGFG1
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: AGFG1
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HRB
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-AGFG1 (ARP40520_P050) antibody is Catalog # AAP40520 (Previous Catalog # AAPP22287)
• Sample Type Confirmation:

  AGFG1 is supported by BioGPS gene expression data to be expressed in HepG2

• Reference: Song,J.H., (2007) Cancer Res. 67 (14), 6946-6955

Target Info

• Gene Symbol: AGFG1
• Gene Full Name: ArfGAP with FG repeats 1
• Alias Symbols: HRB, RAB, RIP
• NCBI Gene Id: 3267
• Protein Name: Arf-GAP domain and FG repeat-containing protein 1
• Description of Target: HRB is related to nucleoporins, a class of proteins that mediate nucleocytoplasmic transport. HRB binds the activation domain of the human immunodeficiency virus Rev protein when Rev is assembled onto its RNA target, and is required for the nuclear export of Rev-directed RNAs.The protein encoded by this gene is related to nucleoporins, a class of proteins that mediate nucleocytoplasmic transport. This encoded protein binds the Rev activation domain when Rev is assembled onto its RNA target and can significantly enhance Rev activity when overexpressed. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P52594
• Protein Accession #: NP_004495
• Nucleotide Accession #: NM_004504
• Protein Size (# AA): 562
• Molecular Weight: 58kDa
• Protein Interactions: NYAP2; POLE2; UBC; ALAD; P3H1; NIF3L1; PPME1; IPO11; SH3GLB1; LAP3; TPRKB; DBNL; HSPBP1; GPN1; ARPC1A; ZPR1; OGT; SURF2; LPP; VCAM1; ITGA4; SUCLA2; APP; EPS15; vpr; ITSN1; APC; RNF216; EPS15L1; PKIA; XPO1; AGFG1; VAMP7; CRM1; KAP104;