Catalog No: ARP42218_P050-HRP
Price: $434.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

HP Antibody - N-terminal region : HRP (ARP42218_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-HP (ARP42218_P050-HRP) antibody
Product Info
ReferenceBorsody,M., (2006) Neurology 66 (5), 634-640
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP: Horseradish Peroxidase
ApplicationWB, IHC
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HP
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 77%; Guinea Pig: 77%; Horse: 85%; Human: 100%; Mouse: 92%; Pig: 85%; Rabbit: 92%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRY
Concentration0.5 mg/ml
Blocking PeptideFor anti-HP (ARP42218_P050-HRP) antibody is Catalog # AAP42218 (Previous Catalog # AAPP24641)
Gene SymbolHP
Gene Full NameHaptoglobin
Alias SymbolsBP, HPA1S, HP2ALPHA2
NCBI Gene Id3240
Protein NameHaptoglobin
Description of TargetHaptoglobin combines with free plasma hemoglobin, preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin, while making the hemoglobin accessible to degradative enzymes.
Uniprot IDP00738
Protein Accession #NP_005134
Nucleotide Accession #NM_005143
Protein Size (# AA)406
Molecular Weight45kDa
Protein InteractionsGADD45G; LAMC3; MVP; WASL; TP63; TGM2; TBL1X; RPL11; SMAD3; ALB; VKORC1; ATP7B; ELAVL1; RBBP6; GRB2; MIS12; C1RL; CD163; ADAMTS4; ITGB2; HBB; ITGAM; CD22;
  1. What is the species homology for "HP Antibody - N-terminal region : HRP (ARP42218_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "HP Antibody - N-terminal region : HRP (ARP42218_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HP Antibody - N-terminal region : HRP (ARP42218_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact

  4. What are other names for "HP Antibody - N-terminal region : HRP (ARP42218_P050-HRP)"?

    This target may also be called "BP, HPA1S, HP2ALPHA2" in publications.

  5. What is the shipping cost for "HP Antibody - N-terminal region : HRP (ARP42218_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HP Antibody - N-terminal region : HRP (ARP42218_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HP Antibody - N-terminal region : HRP (ARP42218_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HP Antibody - N-terminal region : HRP (ARP42218_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HP Antibody - N-terminal region : HRP (ARP42218_P050-HRP)
Your Rating
We found other products you might like!