HP Antibody - N-terminal region (ARP42218_P050)

Catalog#: ARP42218_P050

• Size: 100 ul

• Gene Symbol: HP
• Official Gene Full Name: Haptoglobin
• NCBI Gene Id: 3240
• Protein Name: Haptoglobin
• Swissprot Id: P00738
• Protein Accession #: NP_005134
• Nucleotide Accession #: NM_005143
• Alias Symbols: hp2-alpha, BP, HPA1S, HP2ALPHA2
• Replacement Item: This antibody may replace item sc-134464 from Santa Cruz Biotechnology.
• Description of Target: Haptoglobin combines with free plasma hemoglobin, preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin, while making the hemoglobin accessible to degradative enzymes.
• Protein Size (# AA): 406
• Molecular Weight: 45kDa
• Host: Rabbit
• Clonality: Polyclonal
• Purification: Affinity Purified
• Application: WB, IHC
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express HP.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HP
• Predicted Species Reactivity: Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
• Tested Species Reactivity: Human
• Predicted Homology Based on Immunogen Sequence: Dog: 77%; Guinea Pig: 77%; Horse: 85%; Human: 100%; Mouse: 92%; Pig: 85%; Rabbit: 92%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Protein Interactions: GADD45G; LAMC3; MVP; WASL; TP63; TGM2; TBL1X; RPL11; SMAD3; ALB; VKORC1; ATP7B; ELAVL1; RBBP6; GRB2; MIS12; C1RL; CD163; ADAMTS4; ITGB2; HBB; ITGAM; CD22;
• Blocking Peptide: For anti-HP (ARP42218_P050) antibody is Catalog # AAP42218 (Previous Catalog # AAPP24641)
• Target Reference: Borsody,M., (2006) Neurology 66 (5), 634-640

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Product Protocols: HP antibody tested with Human Jurkat Cells (ARP42218_P050)

Product Protocols: HP (haptoglobin) antibody tested by IHC with Human Liver Tissue ARP42218_P050