Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

HP Antibody - N-terminal region (ARP42218_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42218_P050-FITC Conjugated

ARP42218_P050-HRP Conjugated

ARP42218_P050-Biotin Conjugated

Gene Symbol:
HP
Official Gene Full Name:
Haptoglobin
NCBI Gene Id:
3240
Protein Name:
Haptoglobin
Swissprot Id:
P00738
Protein Accession #:
NP_005134
Nucleotide Accession #:
NM_005143
Alias Symbols:
hp2-alpha, BP, HPA1S, HP2ALPHA2
Replacement Item:
This antibody may replace item sc-134464 from Santa Cruz Biotechnology.
Description of Target:
Haptoglobin combines with free plasma hemoglobin, preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin, while making the hemoglobin accessible to degradative enzymes.
Protein Size (# AA):
406
Molecular Weight:
45kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HP.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human HP
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Dog: 77%; Guinea Pig: 77%; Horse: 85%; Human: 100%; Mouse: 92%; Pig: 85%; Rabbit: 92%; Rat: 92%
Complete computational species homology data:
Anti-HP (ARP42218_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GADD45G; LAMC3; MVP; WASL; TP63; TGM2; TBL1X; RPL11; SMAD3; ALB; VKORC1; ATP7B; ELAVL1; RBBP6; GRB2; MIS12; C1RL; CD163; ADAMTS4; ITGB2; HBB; ITGAM; CD22;
Blocking Peptide:
For anti-HP (ARP42218_P050) antibody is Catalog # AAP42218 (Previous Catalog # AAPP24641)
Datasheets/Manuals:
Printable datasheet for anti-HP (ARP42218_P050) antibody
Target Reference:
Borsody,M., (2006) Neurology 66 (5), 634-640

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...