Search Antibody, Protein, and ELISA Kit Solutions

HP Antibody - N-terminal region (ARP42218_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP42218_P050-FITC Conjugated

ARP42218_P050-HRP Conjugated

ARP42218_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, IHC
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-134464 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human HP
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Dog: 77%; Guinea Pig: 77%; Horse: 85%; Human: 100%; Mouse: 92%; Pig: 85%; Rabbit: 92%; Rat: 92%
Complete computational species homology data:
Anti-HP (ARP42218_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRY
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-HP (ARP42218_P050) antibody is Catalog # AAP42218 (Previous Catalog # AAPP24641)
Datasheets/Manuals:
Printable datasheet for anti-HP (ARP42218_P050) antibody
Target Reference:
Borsody,M., (2006) Neurology 66 (5), 634-640
Gene Symbol:
HP
Official Gene Full Name:
Haptoglobin
Alias Symbols:
hp2-alpha, BP, HPA1S, HP2ALPHA2
NCBI Gene Id:
3240
Protein Name:
Haptoglobin
Description of Target:
Haptoglobin combines with free plasma hemoglobin, preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin, while making the hemoglobin accessible to degradative enzymes.
Swissprot Id:
P00738
Protein Accession #:
NP_005134
Nucleotide Accession #:
NM_005143
Protein Size (# AA):
406
Molecular Weight:
45kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HP.
Protein Interactions:
GADD45G; LAMC3; MVP; WASL; TP63; TGM2; TBL1X; RPL11; SMAD3; ALB; VKORC1; ATP7B; ELAVL1; RBBP6; GRB2; MIS12; C1RL; CD163; ADAMTS4; ITGB2; HBB; ITGAM; CD22;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...