HP Antibody - middle region (ARP42219_P050)

Catalog No: ARP42219_P050

WB Suggested Anti-HP Antibody Titration: 0.0125ug/ml
ELISA Titer: 1:62500
Positive Control: Human Stomach

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HP
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 91%; Pig: 100%; Rabbit: 79%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: NANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HP (ARP42219_P050) antibody is Catalog # AAP42219 (Previous Catalog # AAPP24642)

Target Info

• Gene Symbol: HP
• Gene Full Name: Haptoglobin
• Alias Symbols: BP, HPA1S, HP2ALPHA2
• NCBI Gene Id: 3240
• Protein Name: Haptoglobin
• Description of Target: This gene encodes a preproprotein, which is processed to yield both alpha and beta chains, which subsequently combine as a tetramer to produce haptoglobin. Haptoglobin functions to bind free plasma hemoglobin, which allows degradative enzymes to gain acce
• Uniprot ID: P00738
• Protein Accession #: NP_005134
• Nucleotide Accession #: NM_005143
• Protein Size (# AA): 406
• Molecular Weight: 45kDa
• Protein Interactions: GADD45G; LAMC3; MVP; WASL; TP63; TGM2; TBL1X; RPL11; SMAD3; ALB; VKORC1; ATP7B; ELAVL1; RBBP6; GRB2; MIS12; C1RL; CD163; ADAMTS4; ITGB2; HBB; ITGAM; CD22;