Search Antibody, Protein, and ELISA Kit Solutions

HOXD12 Antibody - N-terminal region (ARP32647_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32647_T100-FITC Conjugated

ARP32647_T100-HRP Conjugated

ARP32647_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Homeobox D12
NCBI Gene Id:
Protein Name:
Homeobox protein Hox-D12
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-82922 from Santa Cruz Biotechnology.
Description of Target:
HOXD12 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. The exact role of this gene has not been determined.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HOXD12.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HOXD12.
The immunogen is a synthetic peptide directed towards the N terminal region of human HOXD12
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-HOXD12 (ARP32647_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MCERSLYRAGYVGSLLNLQSPDSFYFSNLRPNGGQLAALPPISYPRGALP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HOXD12 (ARP32647_T100) antibody is Catalog # AAP32647 (Previous Catalog # AAPP03657)
Printable datasheet for anti-HOXD12 (ARP32647_T100) antibody
Target Reference:
Goodman,F.R. et al., (2002) Am. J. Med. Genet. 112 (3), 256-265

Illig, R., Fritsch, H. & Schwarzer, C. Spatio-temporal expression of HOX genes in human hindgut development. Dev. Dyn. 242, 53-66 (2013). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23073994

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...