Size:100 ul
$229.00
In stock
SKU
ARP32647_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32647_T100-FITC Conjugated

ARP32647_T100-HRP Conjugated

ARP32647_T100-Biotin Conjugated

HOXD12 Antibody - N-terminal region (ARP32647_T100)

Catalog#: ARP32647_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-82922 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HOXD12
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-HOXD12 (ARP32647_T100)
Peptide Sequence Synthetic peptide located within the following region: MCERSLYRAGYVGSLLNLQSPDSFYFSNLRPNGGQLAALPPISYPRGALP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HOXD12 (ARP32647_T100) antibody is Catalog # AAP32647 (Previous Catalog # AAPP03657)
Datasheets/Manuals Printable datasheet for anti-HOXD12 (ARP32647_T100) antibody
Target Reference Goodman,F.R. et al., (2002) Am. J. Med. Genet. 112 (3), 256-265
Publications

Illig, R., Fritsch, H. & Schwarzer, C. Spatio-temporal expression of HOX genes in human hindgut development. Dev. Dyn. 242, 53-66 (2013). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23073994

Gene Symbol HOXD12
Official Gene Full Name Homeobox D12
Alias Symbols HOX4H
NCBI Gene Id 3238
Protein Name Homeobox protein Hox-D12
Description of Target HOXD12 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. The exact role of this gene has not been determined.
Swissprot Id P35452
Protein Accession # NP_067016
Nucleotide Accession # NM_021193
Protein Size (# AA) 279
Molecular Weight 30kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HOXD12.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HOXD12.
Protein Interactions TRAF1; CREBBP; MAFF; MAFG; MEIS1; MAFB; MAFK; MAF;
Write Your Own Review
You're reviewing:HOXD12 Antibody - N-terminal region (ARP32647_T100)
Your Rating