HOXD12 Antibody - middle region : FITC (ARP58025_P050-FITC)

Catalog No: ARP58025_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HOXD12
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 85%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 82%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: AELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKRVVLRE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HOXD12 (ARP58025_P050-FITC) antibody is Catalog # AAP58025 (Previous Catalog # AAPP32448)
• Reference: 0

Target Info

• Gene Symbol: HOXD12
• Gene Full Name: Homeobox D12
• Alias Symbols: HOX4H
• NCBI Gene Id: 3238
• Protein Name: Homeobox protein Hox-D12
• Description of Target: HOXD12 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters,
• Uniprot ID: P35452
• Protein Accession #: NP_067016
• Nucleotide Accession #: NM_021193
• Protein Size (# AA): 279
• Molecular Weight: 30kDa
• Protein Interactions: TRAF1; CREBBP; MAFF; MAFG; MEIS1; MAFB; MAFK; MAF;