Search Antibody, Protein, and ELISA Kit Solutions

HOXB5 Antibody - N-terminal region (ARP58022_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58022_P050-FITC Conjugated

ARP58022_P050-HRP Conjugated

ARP58022_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
HOXB5
Official Gene Full Name:
Homeobox B5
NCBI Gene Id:
3215
Protein Name:
Homeobox protein Hox-B5
Swissprot Id:
P09067
Protein Accession #:
NP_002138
Nucleotide Accession #:
NM_002147
Alias Symbols:
HHO.C10, HOX2, HOX2A, HU-1, Hox2.1
Replacement Item:
This antibody may replace item sc-367901 from Santa Cruz Biotechnology.
Description of Target:
HOXB5 belongs to ANTP homeobox family. It is a nuclear protein with a homeobox DNA-binding domain. HOXB5 gene is included in a cluster of homeobox B genes located on chromosome 17.The protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue.This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
269
Molecular Weight:
29kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HOXB5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HOXB5.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB5
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-HOXB5 (ARP58022_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVGESSRAFPAPAQEPRF
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MAGEA11; CTBP2; CTBP1; TRIM23; UBC;
Blocking Peptide:
For anti-HOXB5 (ARP58022_P050) antibody is Catalog # AAP58022 (Previous Catalog # AAPP32445)
Datasheets/Manuals:
Printable datasheet for anti-HOXB5 (ARP58022_P050) antibody
Target Reference:
Wu,Q., (er) Mol. Cancer 6, 45 (2007)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...