Search Antibody, Protein, and ELISA Kit Solutions

HOXB2 Antibody - middle region (ARP74570_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
homeobox B2
NCBI Gene Id:
Protein Name:
homeobox protein Hox-B2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
K8, HOX2, HOX2H, Hox-2.8,
Replacement Item:
This antibody may replace item sc-17165 from Santa Cruz Biotechnology.
Description of Target:
This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with pancreatic cancer.
Protein Size (# AA):
Molecular Weight:
39 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HOXB2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HOXB2.
The immunogen is a synthetic peptide directed towards the middle region of human HOXB2
Peptide Sequence:
Synthetic peptide located within the following region: QVKVWFQNRRMKHKRQTQHREPPDGEPACPGALEDICDPAEEPAASPGGP
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-HOXB2 (ARP74570_P050) antibody is Catalog # AAP74570
Printable datasheet for anti-HOXB2 (ARP74570_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...