Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP36889_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP36889_P050-FITC Conjugated

ARP36889_P050-HRP Conjugated

ARP36889_P050-Biotin Conjugated

Hoxb13 Antibody - N-terminal region (ARP36889_P050)

Catalog#: ARP36889_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityMouse
Predicted Species ReactivityGuinea Pig, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-28333 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the n terminal region of mouse Hoxb13
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 85%; Human: 79%; Mouse: 100%; Rabbit: 79%; Rat: 93%
Complete computational species homology dataAnti-Hoxb13 (ARP36889_P050)
Peptide SequenceSynthetic peptide located within the following region: MEPGNYATLDGAKDIEGLLGAGGGRNLVSHSSPLASHPAAPTLMPTVNYA
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-Hoxb13 (ARP36889_P050) antibody is Catalog # AAP36889 (Previous Catalog # AAPY00640)
Datasheets/ManualsPrintable datasheet for anti-Hoxb13 (ARP36889_P050) antibody
Publications

Machida, M. et al. Reduction of ribosome biogenesis with activation of the mTOR pathway in denervated atrophic muscle. J. Cell. Physiol. 227, 1569-76 (2012). WB, Guinea Pig, Human, Mouse, Rabbit, Rat 21529712

Gene SymbolHoxb13
Official Gene Full NameHomeobox B13
Alias Symbols-
NCBI Gene Id15408
Protein NameHomeobox protein Hox-B13
Description of TargetHoxb13 is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Swissprot IdP70321
Protein Accession #NP_032293
Nucleotide Accession #NM_008267
Protein Size (# AA)286
Molecular Weight31kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express Hoxb13.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express Hoxb13.
Protein InteractionsOtx2; Dlx5; Dlx1; Alx4; Meis1;
Write Your Own Review
You're reviewing:Hoxb13 Antibody - N-terminal region (ARP36889_P050)
Your Rating
Aviva ChIP Antibodies
Aviva Blast Tool
Aviva Live Chat
Assay Development