Search Antibody, Protein, and ELISA Kit Solutions

Hoxb13 Antibody - N-terminal region (ARP36889_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP36889_P050-FITC Conjugated

ARP36889_P050-HRP Conjugated

ARP36889_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Guinea Pig, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-28333 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the n terminal region of mouse Hoxb13
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 85%; Human: 79%; Mouse: 100%; Rabbit: 79%; Rat: 93%
Complete computational species homology data:
Anti-Hoxb13 (ARP36889_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MEPGNYATLDGAKDIEGLLGAGGGRNLVSHSSPLASHPAAPTLMPTVNYA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Hoxb13 (ARP36889_P050) antibody is Catalog # AAP36889 (Previous Catalog # AAPY00640)
Printable datasheet for anti-Hoxb13 (ARP36889_P050) antibody

Machida, M. et al. Reduction of ribosome biogenesis with activation of the mTOR pathway in denervated atrophic muscle. J. Cell. Physiol. 227, 1569-76 (2012). WB, Guinea Pig, Human, Mouse, Rabbit, Rat 21529712

Gene Symbol:
Official Gene Full Name:
Homeobox B13
Alias Symbols:
NCBI Gene Id:
Protein Name:
Homeobox protein Hox-B13
Description of Target:
Hoxb13 is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Hoxb13.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Hoxb13.
Protein Interactions:
Otx2; Dlx5; Dlx1; Alx4; Meis1;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...