Search Antibody, Protein, and ELISA Kit Solutions

HOXA9 Antibody - middle region : HRP (ARP39932_P050-HRP)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39932_P050 Unconjugated

ARP39932_P050-FITC Conjugated

ARP39932_P050-Biotin Conjugated

Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Gene Symbol:
Official Gene Full Name:
Homeobox A9
NCBI Gene Id:
Protein Name:
Homeobox protein Hox-A9
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ABD-B, HOX1, HOX1.7, HOX1G, MGC1934
Replacement Item:
This antibody may replace item sc-17155 from Santa Cruz Biotechnology.
Description of Target:
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA9 gene is part of the A cluster on chromosome 7 and the protein is a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to the abdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and the NUP98 gene has been associated with myeloid leukemogenesis.In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to the abdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and the NUP98 gene has been associated with myeloid leukemogenesis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HOXA9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HOXA9.
The immunogen is a synthetic peptide directed towards the middle region of human HOXA9
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 85%; Zebrafish: 93%
Complete computational species homology data:
Anti-HOXA9 (ARP39932_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HOXA9 (ARP39932_P050-HRP) antibody is Catalog # AAP39932 (Previous Catalog # AAPP23235)
Printable datasheet for anti-HOXA9 (ARP39932_P050-HRP) antibody
Target Reference:
Whelan,J.T., (2008) Leukemia 22 (6), 1161-1169

Wang, L. et al. BRCA1 is a negative modulator of the PRC2 complex. EMBO J. 32, 1584-97 (2013). WB, Horse, Rabbit, Rat, Human, Dog, Pig, Guinea pig, Mouse, Zebrafish, Bovine, Sheep 23624935

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...