Search Antibody, Protein, and ELISA Kit Solutions

HOXA9 Antibody - middle region (ARP39932_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39932_P050-FITC Conjugated

ARP39932_P050-HRP Conjugated

ARP39932_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Homeobox A9
NCBI Gene Id:
Protein Name:
Homeobox protein Hox-A9
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ABD-B, HOX1, HOX1.7, HOX1G, MGC1934
Replacement Item:
This antibody may replace item sc-17155 from Santa Cruz Biotechnology.
Description of Target:
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA9 gene is part of the A cluster on chromosome 7 and the protein is a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to the abdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and the NUP98 gene has been associated with myeloid leukemogenesis.In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to the abdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and the NUP98 gene has been associated with myeloid leukemogenesis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HOXA9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HOXA9.
The immunogen is a synthetic peptide directed towards the middle region of human HOXA9
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 85%; Zebrafish: 93%
Complete computational species homology data:
Anti-HOXA9 (ARP39932_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HOXA9 (ARP39932_P050) antibody is Catalog # AAP39932 (Previous Catalog # AAPP23235)
Printable datasheet for anti-HOXA9 (ARP39932_P050) antibody
Target Reference:
Whelan,J.T., (2008) Leukemia 22 (6), 1161-1169

Wang, L. et al. BRCA1 is a negative modulator of the PRC2 complex. EMBO J. 32, 1584-97 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 23624935

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...