- Tested Species Reactivity:
- Human
- Predicted Species Reactivity:
- Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Application:
- WB
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Gene Symbol:
- HOXA9
- Official Gene Full Name:
- Homeobox A9
- NCBI Gene Id:
- 3205
- Protein Name:
- Homeobox protein Hox-A9
- Swissprot Id:
- P31269
- Protein Accession #:
- NP_689952
- Nucleotide Accession #:
- NM_152739
- Alias Symbols:
- ABD-B, HOX1, HOX1.7, HOX1G, MGC1934
- Replacement Item:
- This antibody may replace item sc-17155 from Santa Cruz Biotechnology.
- Description of Target:
- In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA9 gene is part of the A cluster on chromosome 7 and the protein is a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to the abdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and the NUP98 gene has been associated with myeloid leukemogenesis.In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to the abdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and the NUP98 gene has been associated with myeloid leukemogenesis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
- Protein Size (# AA):
- 272
- Molecular Weight:
- 30kDa
- Purification:
- Affinity Purified
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express HOXA9.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express HOXA9.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the middle region of human HOXA9
- Predicted Homology Based on Immunogen Sequence:
- Cow: 85%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 85%; Zebrafish: 93%
- Complete computational species homology data:
- Anti-HOXA9 (ARP39932_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: KEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDRAKDE
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- TRIP6; PRMT5; CUL4A; UBC; CREBBP; PBX3; RBPMS; PBX2; PBX1; PLSCR1; MEIS2; MEIS1; SMAD2; SMAD4; JUN; NFKBIA; BCR; KMT2A;
- Blocking Peptide:
- For anti-HOXA9 (ARP39932_P050) antibody is Catalog # AAP39932 (Previous Catalog # AAPP23235)
- Datasheets/Manuals:
- Printable datasheet for anti-HOXA9 (ARP39932_P050) antibody
- Target Reference:
- Whelan,J.T., (2008) Leukemia 22 (6), 1161-1169
- Publications:
Wang, L. et al. BRCA1 is a negative modulator of the PRC2 complex. EMBO J. 32, 1584-97 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish 23624935
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
