Search Antibody, Protein, and ELISA Kit Solutions

HOXA9 Antibody - C-terminal region : FITC (ARP72559_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72559_P050 Unconjugated

ARP72559_P050-HRP Conjugated

ARP72559_P050-Biotin Conjugated

Gene Symbol:
HOXA9
NCBI Gene Id:
3205
Swissprot Id:
P31269
Protein Accession #:
NP_689952
Alias Symbols:
HOXA9, HOX1G,
Replacement Item:
This antibody may replace item sc-17155 from Santa Cruz Biotechnology.
Description of Target:
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to the abdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and the NUP98 gene has been associated with myeloid leukemogenesis. Read-through transcription exists between this gene and the upstream homeobox A10 (HOXA10) gene.
Protein Size (# AA):
272
Molecular Weight:
29kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HOXA9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HOXA9.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human HOXA9
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAANWL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
TRIP6; PRMT5; CUL4A; UBC; CREBBP; PBX3; RBPMS; PBX2; PBX1; PLSCR1; MEIS2; MEIS1; SMAD2; SMAD4; JUN; NFKBIA; BCR; KMT2A;
Blocking Peptide:
For anti-HOXA9 (ARP72559_P050-FITC) antibody is Catalog # AAP72559
Datasheets/Manuals:
Printable datasheet for anti-HOXA9 (ARP72559_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...