- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for HOXA5 Antibody (OAAL00142) |
---|
Predicted Species Reactivity | Human, Mouse |
---|---|
Product Format | Liquid |
Clonality | Monoclonal |
Clone | 3E8 |
Isotype | IgG2b Kappa |
Host | Mouse |
Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot |
Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
Immunogen | HOXA5 (NP_061975.1, 171 a.a. ~ 270 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Peptide Sequence | PAQPQIYPWMRKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP |
Formulation | In 1x PBS, pH 7.4 |
Gene Symbol | HOXA5 |
---|---|
Gene Full Name | homeobox A5 |
Alias Symbols | homeo box 1C;homeo box A5;homeobox protein Hox-1C;homeobox protein Hox-A5;homeobox protein HOXA5;HOX1;HOX1.3;HOX1C. |
NCBI Gene Id | 3202 |
Protein Name | homeobox protein Hox-A5 [Homo sapiens]|Homo sapiens homeobox A5 (HOXA5), mRNA |
Description of Target | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Methylation of this gene may result in the loss of its expression and, since the encoded protein upregulates the tumor suppressor p53, this protein may play an important role in tumorigenesis. [provided by RefSeq |
Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_061975.1 |
Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_019102.1 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "HOXA5 Antibody (OAAL00142)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "HOXA5 Antibody (OAAL00142)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "HOXA5 Antibody (OAAL00142)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "HOXA5 Antibody (OAAL00142)"?
This target may also be called "homeo box 1C;homeo box A5;homeobox protein Hox-1C;homeobox protein Hox-A5;homeobox protein HOXA5;HOX1;HOX1.3;HOX1C." in publications.
-
What is the shipping cost for "HOXA5 Antibody (OAAL00142)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "HOXA5 Antibody (OAAL00142)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "HOXA5 Antibody (OAAL00142)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "HOXA5 Antibody (OAAL00142)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "HOXA5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "HOXA5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "HOXA5"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "HOXA5"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "HOXA5"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "HOXA5"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.