SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP31447_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP31447_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

HOXA5 Antibody - middle region : HRP (ARP31447_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-HOXA5 (ARP31447_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationIHC, WB
Additional InformationIHC Information: Paraffin embedded testis tissue, tested with an antibody dilution of 5 ug/ml, followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HOXA5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: VGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGG
Concentration0.5 mg/ml
Blocking PeptideFor anti-HOXA5 (ARP31447_P050-HRP) antibody is Catalog # AAP31447 (Previous Catalog # AAPP02209)
Publications

Boucherat, O. et al. Partial functional redundancy between Hoxa5 and Hoxb5 paralog genes during lung morphogenesis. Am. J. Physiol. Lung Cell. Mol. Physiol. 304, L817-30 (2013). WB, Pig, Dog, Horse, Rabbit, Human, Bovine, Rat, Mouse 23585229

Gene SymbolHOXA5
Gene Full NameHomeobox A5
Alias SymbolsHOX1, HOX1C, HOX1.3
NCBI Gene Id3202
Protein NameHOXA5 protein EMBL CAG47073.1
Description of TargetIn vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Methylation of this gene may result in the loss of its expression and, since the encoded protein upregulates the tumor suppressor p53, this protein may play an important role in tumorigenesis.
Uniprot IDQ6FG31
Protein Accession #NP_061975
Nucleotide Accession #NM_019102
Protein Size (# AA)270
Molecular Weight29kDa
Protein InteractionsPRMT6; TWIST1; UBC; ELAVL1; SOX2; ZNF408; GTF2A1L; SMAD1; DDIT3; PBX1; MEIS1; FOXA2; CDX4; FOXO1;
  1. What is the species homology for "HOXA5 Antibody - middle region : HRP (ARP31447_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "HOXA5 Antibody - middle region : HRP (ARP31447_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HOXA5 Antibody - middle region : HRP (ARP31447_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HOXA5 Antibody - middle region : HRP (ARP31447_P050-HRP)"?

    This target may also be called "HOX1, HOX1C, HOX1.3" in publications.

  5. What is the shipping cost for "HOXA5 Antibody - middle region : HRP (ARP31447_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HOXA5 Antibody - middle region : HRP (ARP31447_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HOXA5 Antibody - middle region : HRP (ARP31447_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "29kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HOXA5 Antibody - middle region : HRP (ARP31447_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HOXA5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HOXA5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HOXA5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HOXA5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HOXA5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HOXA5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HOXA5 Antibody - middle region : HRP (ARP31447_P050-HRP)
Your Rating
We found other products you might like!