Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

HOXA10 Antibody - N-terminal region (P100767_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

P100767_T100-FITC Conjugated

P100767_T100-HRP Conjugated

P100767_T100-Biotin Conjugated

Gene Symbol:
HOXA10
Official Gene Full Name:
Homeobox A10
NCBI Gene Id:
3206
Protein Name:
Homeobox protein Hox-A10
Swissprot Id:
P31260
Protein Accession #:
NP_061824
Nucleotide Accession #:
NM_018951
Alias Symbols:
PL, HOX1, HOX1H, HOX1.8
Replacement Item:
This antibody may replace item sc-17158 from Santa Cruz Biotechnology.
Description of Target:
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA10 is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function in fertility, embryo viability, and regulation of hematopoietic lineage commitment.
Protein Size (# AA):
393
Molecular Weight:
41kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HOXA10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HOXA10.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human HOXA10
Predicted Species Reactivity:
Dog, Human, Mouse, Rabbit
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Dog: 85%; Human: 92%; Mouse: 78%; Rabbit: 85%
Complete computational species homology data:
Anti-HOXA10 (P100767_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SPI1; COPS5; CREBBP; PBX1; SNAPC1; EMX1; POLR3D; SIRT2; GMNN; EP300; MEIS1; PTPN6; HOXA10; FOXO1;
Blocking Peptide:
For anti-HOXA10 (P100767_T100) antibody is Catalog # AAP31094 (Previous Catalog # AAPP01833)
Datasheets/Manuals:
Printable datasheet for anti-HOXA10 (P100767_T100) antibody
Target Reference:
Akbas,G.E., et al., (2004) Mol. Biol. 340 (5), 1013-1023
Publications:

Ko, S. Y., Lengyel, E. & Naora, H. The Müllerian HOXA10 gene promotes growth of ovarian surface epithelial cells by stimulating epithelial-stromal interactions. Mol. Cell. Endocrinol. 317, 112-9 (2010). IHC, WB, Dog, Human, Mouse, Rabbit 20036708

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...