Catalog No: P100767_T100
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-HOXA10 (P100767_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Dog, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HOXA10
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceDog: 85%; Human: 92%; Mouse: 78%; Rabbit: 85%
Peptide SequenceSynthetic peptide located within the following region: MSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPP
Concentration1.0 mg/ml
Blocking PeptideFor anti-HOXA10 (P100767_T100) antibody is Catalog # AAP31094 (Previous Catalog # AAPP01833)
ReferenceAkbas,G.E., et al., (2004) Mol. Biol. 340 (5), 1013-1023

Ko, S. Y., Lengyel, E. & Naora, H. The Müllerian HOXA10 gene promotes growth of ovarian surface epithelial cells by stimulating epithelial-stromal interactions. Mol. Cell. Endocrinol. 317, 112-9 (2010). 20036708

Gene SymbolHOXA10
Gene Full NameHomeobox A10
Alias SymbolsPL, HOX1, HOX1H, HOX1.8
NCBI Gene Id3206
Protein NameHomeobox protein Hox-A10
Description of TargetIn vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA10 is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function in fertility, embryo viability, and regulation of hematopoietic lineage commitment.
Uniprot IDP31260
Protein Accession #NP_061824
Nucleotide Accession #NM_018951
Protein Size (# AA)393
Molecular Weight41kDa
Protein InteractionsSPI1; COPS5; CREBBP; PBX1; SNAPC1; EMX1; POLR3D; SIRT2; GMNN; EP300; MEIS1; PTPN6; HOXA10; FOXO1;
  1. What is the species homology for "HOXA10 Antibody - N-terminal region (P100767_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Dog, Rabbit".

  2. How long will it take to receive "HOXA10 Antibody - N-terminal region (P100767_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HOXA10 Antibody - N-terminal region (P100767_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HOXA10 Antibody - N-terminal region (P100767_T100)"?

    This target may also be called "PL, HOX1, HOX1H, HOX1.8" in publications.

  5. What is the shipping cost for "HOXA10 Antibody - N-terminal region (P100767_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HOXA10 Antibody - N-terminal region (P100767_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HOXA10 Antibody - N-terminal region (P100767_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HOXA10 Antibody - N-terminal region (P100767_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HOXA10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HOXA10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HOXA10"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HOXA10"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HOXA10"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HOXA10"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HOXA10 Antibody - N-terminal region (P100767_T100)
Your Rating
We found other products you might like!