Search Antibody, Protein, and ELISA Kit Solutions

HOXA10 Antibody - N-terminal region (P100767_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

P100767_T100-FITC Conjugated

P100767_T100-HRP Conjugated

P100767_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Dog, Human, Mouse, Rabbit
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Homeobox A10
NCBI Gene Id:
Protein Name:
Homeobox protein Hox-A10
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-17158 from Santa Cruz Biotechnology.
Description of Target:
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA10 is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function in fertility, embryo viability, and regulation of hematopoietic lineage commitment.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HOXA10.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HOXA10.
The immunogen is a synthetic peptide directed towards the N terminal region of human HOXA10
Predicted Homology Based on Immunogen Sequence:
Dog: 85%; Human: 92%; Mouse: 78%; Rabbit: 85%
Complete computational species homology data:
Anti-HOXA10 (P100767_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPP
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HOXA10 (P100767_T100) antibody is Catalog # AAP31094 (Previous Catalog # AAPP01833)
Printable datasheet for anti-HOXA10 (P100767_T100) antibody
Target Reference:
Akbas,G.E., et al., (2004) Mol. Biol. 340 (5), 1013-1023

Ko, S. Y., Lengyel, E. & Naora, H. The Müllerian HOXA10 gene promotes growth of ovarian surface epithelial cells by stimulating epithelial-stromal interactions. Mol. Cell. Endocrinol. 317, 112-9 (2010). IHC, WB, Dog, Human, Mouse, Rabbit 20036708

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...