Size:100 ul
Special Price $229.00 Regular Price $249.00
In Stock
SKU
P100767_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

P100767_T100-FITC Conjugated

P100767_T100-HRP Conjugated

P100767_T100-Biotin Conjugated

HOXA10 Antibody - N-terminal region (P100767_T100)

Catalog#: P100767_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Human, Mouse, Rabbit
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-17158 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HOXA10
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Dog: 85%; Human: 92%; Mouse: 78%; Rabbit: 85%
Complete computational species homology data Anti-HOXA10 (P100767_T100)
Peptide Sequence Synthetic peptide located within the following region: MSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HOXA10 (P100767_T100) antibody is Catalog # AAP31094 (Previous Catalog # AAPP01833)
Datasheets/Manuals Printable datasheet for anti-HOXA10 (P100767_T100) antibody
Target Reference Akbas,G.E., et al., (2004) Mol. Biol. 340 (5), 1013-1023
Publications

Ko, S. Y., Lengyel, E. & Naora, H. The Müllerian HOXA10 gene promotes growth of ovarian surface epithelial cells by stimulating epithelial-stromal interactions. Mol. Cell. Endocrinol. 317, 112-9 (2010). IHC, WB, Dog, Human, Mouse, Rabbit 20036708

Gene Symbol HOXA10
Official Gene Full Name Homeobox A10
Alias Symbols PL, HOX1, HOX1H, HOX1.8
NCBI Gene Id 3206
Protein Name Homeobox protein Hox-A10
Description of Target In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA10 is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function in fertility, embryo viability, and regulation of hematopoietic lineage commitment.
Swissprot Id P31260
Protein Accession # NP_061824
Nucleotide Accession # NM_018951
Protein Size (# AA) 393
Molecular Weight 41kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HOXA10.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HOXA10.
Protein Interactions SPI1; COPS5; CREBBP; PBX1; SNAPC1; EMX1; POLR3D; SIRT2; GMNN; EP300; MEIS1; PTPN6; HOXA10; FOXO1;
  1. What is the species homology for "HOXA10 Antibody - N-terminal region (P100767_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Dog, Human, Mouse, Rabbit".

  2. How long will it take to receive "HOXA10 Antibody - N-terminal region (P100767_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HOXA10 Antibody - N-terminal region (P100767_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HOXA10 Antibody - N-terminal region (P100767_T100)"?

    This target may also be called "PL, HOX1, HOX1H, HOX1.8" in publications.

  5. What is the shipping cost for "HOXA10 Antibody - N-terminal region (P100767_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HOXA10 Antibody - N-terminal region (P100767_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HOXA10 Antibody - N-terminal region (P100767_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HOXA10 Antibody - N-terminal region (P100767_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HOXA10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HOXA10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HOXA10"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HOXA10"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HOXA10"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HOXA10"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HOXA10 Antibody - N-terminal region (P100767_T100)
Your Rating
We found other products you might like!