HOXA10 Antibody - N-terminal region : Biotin (P100932_T100-Biotin)

Catalog No: P100932_T100-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Cow, Dog, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HOXA10
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HOXA10 (P100932_T100-Biotin) antibody is Catalog # AAP31285 (Previous Catalog # AAPP02034)
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that HOXA10 is expressed in Jurkat

• Reference: Akbas,G.E., et al., (2004) J. Mol. Biol. 340 (5), 1013-1023

Target Info

• Gene Symbol: HOXA10
• Gene Full Name: Homeobox A10
• Alias Symbols: PL, HOX1, HOX1H, HOX1.8
• NCBI Gene Id: 3206
• Protein Name: Homeobox protein Hox-A10
• Description of Target: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function in fertility, embryo viability, and regulation of hematopoietic lineage commitment.
• Uniprot ID: P31260
• Protein Accession #: NP_061824
• Nucleotide Accession #: NM_018951
• Protein Size (# AA): 393
• Molecular Weight: 41kDa
• Protein Interactions: SPI1; COPS5; CREBBP; PBX1; SNAPC1; EMX1; POLR3D; SIRT2; GMNN; EP300; MEIS1; PTPN6; HOXA10; FOXO1;