Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP37062_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP37062_P050-FITC Conjugated

ARP37062_P050-HRP Conjugated

ARP37062_P050-Biotin Conjugated

Hoxa1 Antibody - C-terminal region (ARP37062_P050)

Catalog#: ARP37062_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityMouse
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-115272 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the c terminal region of mouse Hoxa1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 86%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Complete computational species homology dataAnti-Hoxa1 (ARP37062_P050)
Peptide SequenceSynthetic peptide located within the following region: ETQVKIWFQNRRMKQKKREKEGLLPISPATPPGSDEKTEESSEKSSPSPS
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-Hoxa1 (ARP37062_P050) antibody is Catalog # AAP37062 (Previous Catalog # AAPP09256)
Datasheets/ManualsPrintable datasheet for anti-Hoxa1 (ARP37062_P050) antibody
Gene SymbolHoxa1
Official Gene Full NameHomeobox A1
Alias SymbolsERA1, Hox-1.6
NCBI Gene Id15394
Protein NameHomeo box A1 EMBL AAI38098.1
Description of TargetThe function of this protein remains unknown.
Swissprot IdB9EHK7
Protein Accession #NP_034579
Nucleotide Accession #NM_010449
Protein Size (# AA)336
Molecular Weight36
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express Hoxa1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express Hoxa1.
Protein InteractionsKRTAP26-1; LNX2; FAM154A; MGAT5B; HSFY1; KRTAP3-3; C1orf94; CRACR2A; PRRC2B; KRTAP3-2; KRTAP4-12; ABHD17A; HSD3B7; CCDC33; ADCK4; TRAPPC6A; SMOC1; PLSCR4; ADAMTSL4; EFEMP2; LGALS13; DKKL1; FHL5; LPXN; RAB33A; PDLIM7; RGS20; OGT; ZBTB16; TRIP6; TRAF2; TRAF
Write Your Own Review
You're reviewing:Hoxa1 Antibody - C-terminal region (ARP37062_P050)
Your Rating
Aviva Pathways
Aviva ChIP Antibodies
Aviva HIS tag Deal
Aviva Travel Grant