Search Antibody, Protein, and ELISA Kit Solutions

Hoxa1 Antibody - C-terminal region (ARP37062_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37062_P050-FITC Conjugated

ARP37062_P050-HRP Conjugated

ARP37062_P050-Biotin Conjugated

Gene Symbol:
Hoxa1
Official Gene Full Name:
Homeobox A1
NCBI Gene Id:
15394
Protein Name:
Homeo box A1 EMBL AAI38098.1
Swissprot Id:
B9EHK7
Protein Accession #:
NP_034579
Nucleotide Accession #:
NM_010449
Alias Symbols:
ERA1, Hox-1.6
Replacement Item:
This antibody may replace item sc-115272 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
336
Molecular Weight:
36
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Hoxa1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Hoxa1.
Immunogen:
The immunogen is a synthetic peptide directed towards the c terminal region of mouse Hoxa1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 86%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Complete computational species homology data:
Anti-Hoxa1 (ARP37062_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ETQVKIWFQNRRMKQKKREKEGLLPISPATPPGSDEKTEESSEKSSPSPS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
KRTAP26-1; LNX2; FAM154A; MGAT5B; HSFY1; KRTAP3-3; C1orf94; CRACR2A; PRRC2B; KRTAP3-2; KRTAP4-12; ABHD17A; HSD3B7; CCDC33; ADCK4; TRAPPC6A; SMOC1; PLSCR4; ADAMTSL4; EFEMP2; LGALS13; DKKL1; FHL5; LPXN; RAB33A; PDLIM7; RGS20; OGT; ZBTB16; TRIP6; TRAF2; TRAF
Blocking Peptide:
For anti-Hoxa1 (ARP37062_P050) antibody is Catalog # AAP37062 (Previous Catalog # AAPP09256)
Datasheets/Manuals:
Printable datasheet for anti-Hoxa1 (ARP37062_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...