Search Antibody, Protein, and ELISA Kit Solutions

HNRPM antibody - N-terminal region (ARP40620_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40620_P050-FITC Conjugated

ARP40620_P050-HRP Conjugated

ARP40620_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Heterogeneous nuclear ribonucleoprotein M
Protein Name:
Heterogeneous nuclear ribonucleoprotein M
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-134360 from Santa Cruz Biotechnology.
Description of Target:
HNRPM belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. HNRPM has three repeats of quasi-RRM domains that bind to RNAs. HNRPM also constitutes a monomer of the N-acetylglucosamine-specific receptor which is postulated to trigger selective recycling of immature GlcNAc-bearing thyroglobulin molecules.This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs. This protein also constitutes a monomer of the N-acetylglucosamine-specific receptor which is postulated to trigger selective recycling of immature GlcNAc-bearing thyroglobulin molecules. Multiple alternatively spliced transcript variants are known for this gene but only two transcripts has been isolated.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HNRPM.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HNRPM.
The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPM
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-HNRPM (ARP40620_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HNRNPM (ARP40620_P050) antibody is Catalog # AAP40620 (Previous Catalog # AAPP22380)
Printable datasheet for anti-HNRNPM (ARP40620_P050) antibody
Sample Type Confirmation:

HNRNPM is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Huelga, S. C. et al. Integrative genome-wide analysis reveals cooperative regulation of alternative splicing by hnRNP proteins. Cell Rep. 1, 167-78 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 22574288

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...