Search Antibody, Protein, and ELISA Kit Solutions

HNRPH3 antibody - N-terminal region (ARP40721_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40721_T100-FITC Conjugated

ARP40721_T100-HRP Conjugated

ARP40721_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Heterogeneous nuclear ribonucleoprotein H3 (2H9)
Protein Name:
Heterogeneous nuclear ribonucleoprotein H3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-132303 from Santa Cruz Biotechnology.
Description of Target:
HNRPH3 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein has two repeats of quasi-RRM domains that bind to RNAs. It is localized in nuclear bodies of the nucleus. This protein is involved in the splicing process and it also participates in early heat shock-induced splicing arrest by transiently leaving the hnRNP complexes.This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It is localized in nuclear bodies of the nucleus. This protein is involved in the splicing process and it also participates in early heat shock-induced splicing arrest by transiently leaving the hnRNP complexes. Multiple alternative transcript variants seem to be present for this gene and some appear to have intronic regions in the mRNA. Presently, only two transcript variants are fully described.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HNRPH3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HNRPH3.
The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPH3
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-HNRPH3 (ARP40721_T100)
Peptide Sequence:
Synthetic peptide located within the following region: DYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HNRNPH3 (ARP40721_T100) antibody is Catalog # AAP40721 (Previous Catalog # AAPY00973)
Printable datasheet for anti-HNRNPH3 (ARP40721_T100) antibody
Sample Type Confirmation:

HNRNPH3 is strongly supported by BioGPS gene expression data to be expressed in Raji

Target Reference:
Andersen,J.S., (2002) Curr. Biol. 12 (1), 1-11

Larriba, M. J. et al. Novel snail1 target proteins in human colon cancer identified by proteomic analysis. PLoS One 5, e10221 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 20421926

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...